StarFunc result for job id Q9H0F6

User Input

>input (387 residues)
MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLEL
LGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGAT
VEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLA
RAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPGPIRLQVTLEDAASAASAASSAHV
ALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPERSLASYGVRQDGDPAFLYLL
SAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQPSWSCPSCTFI
NAPDRPGCEMCSTQRPCTWDPLAAAST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0F6	1.000	1.000	3.319E-75	387	1.000	1.000	Q9H0F6.pdb.gz	SHRPN_HUMAN Sharpin OS=Homo sapiens OX=9606 GN=SHARPIN PE=1 SV=1
2	AFDB:Q91WA6	0.578	0.587	3.139E-57	380	0.736	0.750	Q91WA6.pdb.gz	SHRPN_MOUSE Sharpin OS=Mus musculus OX=10090 GN=Sharpin PE=1 SV=1
3	AFDB:Q9EQL9	0.717	0.727	3.708E-56	381	0.729	0.740	Q9EQL9.pdb.gz	SHRPN_RAT Sharpin OS=Rattus norvegicus OX=10116 GN=Sharpin PE=1 SV=1
4	AFDB:A9JTG5	0.348	0.214	1.062E-30	714	0.370	0.200	A9JTG5.pdb.gz	HOIL1_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=rbck1 PE=2 SV=1
5	AFDB:X1WDE8	0.273	0.269	5.458E-29	394	0.372	0.365	X1WDE8.pdb.gz	X1WDE8_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=sharpin PE=4 SV=1
6	AFDB:Q9BYM8	0.309	0.247	4.365E-18	510	0.248	0.188	Q9BYM8.pdb.gz	HOIL1_HUMAN RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=RBCK1 PE=1 SV=2
7	AFDB:Q6GMF9	0.288	0.223	1.444E-13	515	0.186	0.140	Q6GMF9.pdb.gz	Q6GMF9_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=zgc:91964 PE=2 SV=1
8	AFDB:Q9JID9	0.231	0.153	6.664E-7	621	0.176	0.110	Q9JID9.pdb.gz	SH2B2_MOUSE SH2B adapter protein 2 OS=Mus musculus OX=10090 GN=Sh2b2 PE=1 SV=2
9	AFDB:Q99JP6	0.240	0.259	7.067E-7	356	0.088	0.096	Q99JP6.pdb.gz	HOME3_MOUSE Homer protein homolog 3 OS=Mus musculus OX=10090 GN=Homer3 PE=1 SV=2
10	AFDB:Q7Z698	0.226	0.211	7.495E-7	418	0.150	0.139	Q7Z698.pdb.gz	SPRE2_HUMAN Sprouty-related, EVH1 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SPRED2 PE=1 SV=2
11	PDB:3dbhI	0.179	0.658	1.028E-4	86	0.039	0.174	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
12	PDB:3ai5A	0.171	0.218	3.975E-4	299	0.039	0.050	3ai5A.pdb.gz
13	PDB:7rbsB	0.162	0.359	4.742E-4	157	0.044	0.108	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
14	PDB:3plvA	0.184	0.777	7.589E-4	80	0.041	0.200	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
15	PDB:4pyuA	0.176	0.762	9.053E-4	76	0.036	0.184	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
16	PDB:6mdhA	0.172	0.414	9.053E-4	149	0.034	0.087	6mdhA.pdb.gz
17	PDB:1k5dB	0.250	0.592	1.080E-3	146	0.054	0.144	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
18	PDB:6yvaC	0.179	0.420	1.080E-3	155	0.034	0.084	6yvaC.pdb.gz
19	PDB:5xqmA	0.163	0.552	1.215E-3	90	0.026	0.111	5xqmA.pdb.gz
20	PDB:2kr0A	0.199	0.191	1.944E-3	407	0.072	0.069	2kr0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H0F6	0.0	756	387	1.000	1.000	SHRPN_HUMAN Sharpin OS=Homo sapiens OX=9606 GN=SHARPIN PE=1 SV=1
2	Q9EQL9	2.84e-163	464	381	0.695	0.706	SHRPN_RAT Sharpin OS=Rattus norvegicus OX=10116 GN=Sharpin PE=1 SV=1
3	Q91WA6	1.97e-161	459	380	0.703	0.716	SHRPN_MOUSE Sharpin OS=Mus musculus OX=10090 GN=Sharpin PE=1 SV=1
4	X1WDE8	6.85e-61	203	394	0.377	0.371	X1WDE8_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=sharpin PE=4 SV=1
5	A9JTG5	1.67e-57	201	714	0.385	0.209	HOIL1_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=rbck1 PE=2 SV=1
6	Q9BYM8	1.98e-40	151	510	0.258	0.196	HOIL1_HUMAN RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=RBCK1 PE=1 SV=2
7	Q9WUB0	3.16e-38	145	508	0.238	0.181	HOIL1_MOUSE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Mus musculus OX=10090 GN=Rbck1 PE=1 SV=2
8	Q62921	2.72e-37	143	508	0.233	0.177	HOIL1_RAT RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Rbck1 PE=1 SV=3
9	Q6GMF9	3.72e-24	105	515	0.178	0.134	Q6GMF9_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=zgc:91964 PE=2 SV=1
10	Q5FWF4	0.023	39.3	1079	0.047	0.017	ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens OX=9606 GN=ZRANB3 PE=1 SV=2
11	F5GYN7	0.042	38.5	625	0.047	0.029	F5GYN7_HUMAN Zinc finger RANBP2-type containing 3 OS=Homo sapiens OX=9606 GN=ZRANB3 PE=1 SV=2
12	Q8K203	0.12	37.0	606	0.041	0.026	NEIL3_MOUSE Endonuclease 8-like 3 OS=Mus musculus OX=10090 GN=Neil3 PE=1 SV=1
13	P60670	0.34	35.4	608	0.031	0.020	NPL4_MOUSE Nuclear protein localization protein 4 homolog OS=Mus musculus OX=10090 GN=Nploc4 PE=1 SV=3
14	Q9ES54	0.34	35.4	608	0.031	0.020	NPL4_RAT Nuclear protein localization protein 4 homolog OS=Rattus norvegicus OX=10116 GN=Nploc4 PE=1 SV=3
15	Q8TAT6	0.36	35.4	608	0.034	0.021	NPL4_HUMAN Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3
16	Q9VBP9	0.39	35.4	652	0.028	0.017	NPL4_DROME Nuclear protein localization protein 4 homolog OS=Drosophila melanogaster OX=7227 GN=Npl4 PE=1 SV=3
17	O75844	0.72	34.3	475	0.036	0.029	FACE1_HUMAN CAAX prenyl protease 1 homolog OS=Homo sapiens OX=9606 GN=ZMPSTE24 PE=1 SV=2
18	Q8TAT5	0.79	34.3	605	0.031	0.020	NEIL3_HUMAN Endonuclease 8-like 3 OS=Homo sapiens OX=9606 GN=NEIL3 PE=1 SV=3
19	Q9UGI0	0.85	34.3	708	0.041	0.023	ZRAN1_HUMAN Ubiquitin thioesterase ZRANB1 OS=Homo sapiens OX=9606 GN=ZRANB1 PE=1 SV=2
20	Q9LP67	0.88	34.3	455	0.028	0.024	Q9LP67_ARATH T1N15.19 OS=Arabidopsis thaliana OX=3702 GN=At1g48570 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16764 Sharpin_PH	6e-44	160.1	Sharpin PH domain
2	PF00240 ubiquitin	1.6e+02	13.5	Ubiquitin family
3	PF00641 zf-RanBP	0.0078	26.8	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381698

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315112	0.999	E3 ubiquitin-protein ligase RNF31
2	9606.ENSP00000348632	0.997	RanBP-type and C3HC4-type zinc finger-containing protein 1
3	9606.ENSP00000483825	0.994	NF-kappa-B essential modulator
4	9606.ENSP00000284274	0.984	Ubiquitin thioesterase otulin
5	9606.ENSP00000392025	0.968	Ubiquitin carboxyl-terminal hydrolase CYLD
6	9606.ENSP00000398698	0.968	Tumor necrosis factor
7	9606.ENSP00000481570	0.962	Tumor necrosis factor alpha-induced protein 3
8	9606.ENSP00000293441	0.961	SH3 and multiple ankyrin repeat domains protein 1
9	9606.ENSP00000162749	0.956	Tumor necrosis factor receptor superfamily member 1A
10	9606.ENSP00000362994	0.951	TNF receptor-associated factor 1
11	9606.ENSP00000477613	0.938	Baculoviral IAP repeat-containing protein 2
12	9606.ENSP00000416799	0.930	Spermatogenesis-associated protein 2
13	9606.ENSP00000462729	0.929	OTU domain-containing protein 7B
14	9606.ENSP00000259808	0.927	Receptor-interacting serine/threonine-protein kinase 1
15	9606.ENSP00000260187	0.924	Ubiquitin carboxyl-terminal hydrolase 2
16	9606.ENSP00000265560	0.921	Ubiquitin carboxyl-terminal hydrolase 4
17	9606.ENSP00000342626	0.915	Eyes absent homolog 1
18	9606.ENSP00000263464	0.910	Baculoviral IAP repeat-containing protein 3
19	9606.ENSP00000356981	0.907	Ubiquitin carboxyl-terminal hydrolase 21
20	9606.ENSP00000426909	0.902	Receptor of activated protein C kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031593	1.000	polyubiquitin modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.995	positive regulation of cellular process
GO:0043122	0.995	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043123	0.988	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0050896	0.985	response to stimulus
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.976	primary metabolic process
GO:0006807	0.968	nitrogen compound metabolic process
GO:0043170	0.961	macromolecule metabolic process
GO:0070647	0.954	protein modification by small protein conjugation or removal
GO:0006950	0.932	response to stress
GO:0060759	0.932	regulation of response to cytokine stimulus
GO:0009605	0.916	response to external stimulus
GO:0009607	0.904	response to biotic stimulus
GO:0009987	0.874	cellular process
GO:0016567	0.836	protein ubiquitination
GO:0001959	0.817	regulation of cytokine-mediated signaling pathway
GO:0044419	0.812	biological process involved in interspecies interaction between organisms
GO:0006952	0.808	defense response
GO:0043207	0.808	response to external biotic stimulus
GO:0051707	0.781	response to other organism
GO:0010803	0.639	regulation of tumor necrosis factor-mediated signaling pathway
GO:0000209	0.553	protein polyubiquitination
GO:0098542	0.372	defense response to other organism
GO:0048519	0.342	negative regulation of biological process
GO:0060255	0.330	regulation of macromolecule metabolic process
GO:0080134	0.328	regulation of response to stress
GO:0051171	0.324	regulation of nitrogen compound metabolic process
GO:0080090	0.323	regulation of primary metabolic process
GO:0009617	0.318	response to bacterium
GO:0032501	0.300	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.997	protein-containing complex
GO:1902494	0.980	catalytic complex
GO:0140535	0.959	intracellular protein-containing complex
GO:1990234	0.898	transferase complex
GO:0043226	0.878	organelle
GO:0000151	0.823	ubiquitin ligase complex
GO:0043227	0.716	membrane-bounded organelle
GO:0043229	0.715	intracellular organelle
GO:0016020	0.637	membrane
GO:0043231	0.568	intracellular membrane-bounded organelle
GO:0005634	0.433	nucleus
GO:0071797	0.397	LUBAC complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]