StarFunc result for job id Q9H0H0

User Input

>input (1204 residues)
MKDQQTVIMTECTSLQFVSPFAFEAMQKVDVVCLASLSDPELRLLLPCLVRMALCAPADQ
SQSWAQDKKLILRLLSGVEAVNSIVALLSVDFHALEQDASKEQQLRHKLGGGSGESILVS
QLQHGLTLEFEHSDSPRRLRLVLSELLAIMNKVSESNGEFFFKSSELFESPVYLEEAADV
LCILQAELPSLLPIVDVAEALLHVRNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEES
LGGRRRTDALRFLCKMNPSQALKVRGMVVEECHLPGLGVALTLDHTKNEACEDGVSDLVC
FVSGLLLGTNAKVRTWFGTFIRNGQQRKRETSSSVLWQMRRQLLLELMGILPTVRSTRIV
EEADVDMEPNVSVYSGLKEEHVVKASALLRLYCALMGIAGLKPTEEEAEQLLQLMTSRPP
ATPAGVRFVSLSFCMLLAFSTLVSTPEQEQLMVVWLSWMIKEEAYFESTSGVSASFGEML
LLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPV
TSNLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYRQLCETSTPLHPQLLPLIDVYI
NSILTPASKSNPEATNQPVTEQEILNIFQGVIGGDNIRLNQRFSITAQLLVLYYILSYEE
ALLANTKTLAAMQRKPKSYSSSLMDQIPIKFLIRQAQGLQQELGGLHSALLRLLATNYPH
LCIVDDWICEEEITGTDALLRRMLLTNNAKNHSPKQLQEAFSAVPVNNTQVMQIIEHLTL
LSASELIPYAEVLTSNMSQLLNSGVPRRILQTVNKLWMVLNTVMPRRLWVMTVNALQPSI
KFVRQQKYTQNDLMIDPLIVLRCDQRVHRCPPLMDITLHMLNGYLLASKAYLSAHLKETE
QDRPSQNNTIGLVGQTDAPEVTREELKNALLAAQDSAAVQILLEICLPTEEEKANGVNPD
SLLRNVQSVITTSAPNKGMEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGY
PCELLPLTVAGIPSMHICLDFIPELIAQPELEKQIFAIQLLSHLCIQYALPKSLSVARLA
VNVMGTLLTVLTQAKRYAFFMPTLPSLVSFCRAFPPLYEDIMSLLIQIGQVCASDVATQT
RDIDPIITRLQQIKEKPSGWSQICKDSSYKNGSRDTGSMDPDVQLCHCIERTVIEIINMS
VSGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0H0	1.000	1.000	0.000	1204	1.000	1.000	Q9H0H0.pdb.gz	INT2_HUMAN Integrator complex subunit 2 OS=Homo sapiens OX=9606 GN=INTS2 PE=1 SV=2
2	PDB:7pksb	0.777	0.885	6.756E-92	1047	0.848	0.975	7pksb.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
3	PDB:7cunB	0.597	0.671	6.125E-74	1058	0.861	0.980	7cunB.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
4	AFDB:Q9VX31	0.762	0.823	6.943E-61	1105	0.355	0.387	Q9VX31.pdb.gz	INT2_DROME Integrator complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=IntS2 PE=1 SV=2
5	AFDB:Q9R0L4	0.150	0.144	4.391E-6	1273	0.123	0.116	Q9R0L4.pdb.gz	CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus OX=10116 GN=Cand2 PE=1 SV=1
6	PDB:3w3uA	0.153	0.173	5.195E-6	1030	0.125	0.146	3w3uA.pdb.gz
7	AFDB:Q9YHY6	0.108	0.101	1.109E-5	1364	0.145	0.128	Q9YHY6.pdb.gz	CND1_XENLA Condensin complex subunit 1 OS=Xenopus laevis OX=8355 GN=ncapd2 PE=1 SV=1
8	AFDB:Q387F9	0.110	0.109	1.894E-5	1220	0.139	0.137	Q387F9.pdb.gz	Q387F9_TRYB2 TATA-binding protein interacting (TIP20) domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0210 PE=3 SV=1
9	AFDB:Q8K2Z4	0.119	0.108	3.010E-5	1392	0.133	0.115	Q8K2Z4.pdb.gz	CND1_MOUSE Condensin complex subunit 1 OS=Mus musculus OX=10090 GN=Ncapd2 PE=1 SV=2
10	AFDB:O60518	0.123	0.131	4.455E-5	1105	0.121	0.132	O60518.pdb.gz	RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens OX=9606 GN=RANBP6 PE=1 SV=2
11	AFDB:Q9P3A8	0.172	0.170	5.324E-5	1220	0.135	0.134	Q9P3A8.pdb.gz	CAND1_SCHPO Cullin-associated NEDD8-dissociated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=knd1 PE=3 SV=1
12	PDB:7unkA	0.120	0.134	6.078E-5	1047	0.115	0.132	7unkA.pdb.gz
13	AFDB:Q93VS8	0.158	0.166	7.080E-5	1116	0.101	0.109	Q93VS8.pdb.gz	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1
14	AFDB:O00410	0.132	0.138	8.462E-5	1097	0.111	0.122	O00410.pdb.gz	IPO5_HUMAN Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4
15	PDB:7mvvA	0.164	0.144	1.332E-4	1542	0.156	0.122	7mvvA.pdb.gz	Architecture of the linker-scaffold in the nuclear pore.
16	PDB:3w3zA	0.169	0.189	1.430E-4	1013	0.130	0.154	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
17	PDB:6xu2A	0.138	0.149	1.482E-4	1091	0.118	0.130	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
18	PDB:6bcuA	0.092	0.069	2.441E-4	2204	0.140	0.077	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
19	PDB:6n1zA	0.113	0.128	2.529E-4	961	0.091	0.113	6n1zA.pdb.gz
20	PDB:7mqaLM	0.145	0.103	2.716E-4	2041	0.134	0.079	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H0H0	0.0	2473	1204	1.000	1.000	INT2_HUMAN Integrator complex subunit 2 OS=Homo sapiens OX=9606 GN=INTS2 PE=1 SV=2
2	Q9VX31	0.0	763	1105	0.363	0.395	INT2_DROME Integrator complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=IntS2 PE=1 SV=2
3	Q9FZ70	1.9	35.0	416	0.025	0.072	FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570 OS=Arabidopsis thaliana OX=3702 GN=At1g13570 PE=2 SV=1
4	P27398	2.6	34.7	1594	0.017	0.013	CAND_DROME Calpain-D OS=Drosophila melanogaster OX=7227 GN=sol PE=1 SV=2
5	Q5T3J3	3.2	34.3	769	0.041	0.064	LRIF1_HUMAN Ligand-dependent nuclear receptor-interacting factor 1 OS=Homo sapiens OX=9606 GN=LRIF1 PE=1 SV=1
6	Q5A762	3.6	34.3	1606	0.017	0.012	MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MLT1 PE=1 SV=1
7	Q7YR75	3.9	33.1	198	0.022	0.131	RM12_BOVIN Large ribosomal subunit protein bL12m OS=Bos taurus OX=9913 GN=MRPL12 PE=1 SV=1
8	Q9LVW3	4.8	33.5	468	0.024	0.062	AXYLT_ARATH Anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase OS=Arabidopsis thaliana OX=3702 GN=A3G2XYLT PE=1 SV=1
9	Q9NVH2	4.9	33.9	962	0.018	0.023	INT7_HUMAN Integrator complex subunit 7 OS=Homo sapiens OX=9606 GN=INTS7 PE=1 SV=1
10	Q8IYX8	8.4	32.7	460	0.014	0.037	CE57L_HUMAN Centrosomal protein CEP57L1 OS=Homo sapiens OX=9606 GN=CEP57L1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14750 INTS2	0	1626.0	Integrator complex subunit 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000414237

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355961	0.999	Integrator complex subunit 7
2	9606.ENSP00000385722	0.998	Integrator complex subunit 1
3	9606.ENSP00000430338	0.998	Integrator complex subunit 8
4	9606.ENSP00000445001	0.997	Integrator complex subunit 11
5	9606.ENSP00000327889	0.994	Integrator complex subunit 5
6	9606.ENSP00000434466	0.994	Integrator complex subunit 4
7	9606.ENSP00000429065	0.993	Integrator complex subunit 9
8	9606.ENSP00000310260	0.990	Integrator complex subunit 6
9	9606.ENSP00000261191	0.984	Integrator complex subunit 13
10	9606.ENSP00000318641	0.977	Integrator complex subunit 3
11	9606.ENSP00000381064	0.977	Integrator complex subunit 10
12	9606.ENSP00000408429	0.975	Integrator complex subunit 14
13	9606.ENSP00000415433	0.967	Integrator complex subunit 12
14	9606.ENSP00000418447	0.893	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
15	9606.ENSP00000340220	0.849	Uncharacterized protein C7orf26
16	9606.ENSP00000480158	0.814	DNA-directed RNA polymerase II subunit RPB1
17	9606.ENSP00000359788	0.779	Integrator complex subunit 6-like
18	9606.ENSP00000358064	0.764	Regulation of nuclear pre-mRNA domain containing 2
19	9606.ENSP00000386186	0.759	Tigger transposable element-derived protein 1
20	9606.ENSP00000331087	0.750	Protein TSSC4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0044238	0.988	primary metabolic process
GO:0006807	0.983	nitrogen compound metabolic process
GO:0043170	0.981	macromolecule metabolic process
GO:0016073	0.936	snRNA metabolic process
GO:0016180	0.896	snRNA processing
GO:0050789	0.513	regulation of biological process
GO:0050794	0.496	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0016020	0.999	membrane
GO:0032039	0.702	integrator complex
GO:0005829	0.319	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]