StarFunc result for job id Q9H0H3

User Input

>input (589 residues)
MSVSVHETRKSRSSTGSMNVTLFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCH
RAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENAESL
LEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVR
QSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLAL
LPSDCLQEAVSSEALLMADERTKLIMDEALRCKTRILQNDGVVTSPCARPRKAGHTLLIL
GGQTFMCDKIYQVDHKAKEIIPKADLPSPRKEFSASAIGCKVYVTGGRGSENGVSKDVWV
YDTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPG
ANKWMMVAPLRDGVSNAAVVSAKLKLFVFGGTSIHRDMVSKVQCYDPSENRWTIKAECPQ
PWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKL
YVVGGYFGTQRCKTLDCYDPTSDTWNCITTVPYSLIPTAFVSTWKHLPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R2P1	0.930	0.930	0.000	589	0.949	0.949	Q8R2P1.pdb.gz	KLH25_MOUSE Kelch-like protein 25 OS=Mus musculus OX=10090 GN=Klhl25 PE=1 SV=1
2	AFDB:O14682	0.899	0.899	3.530E-93	589	0.747	0.747	O14682.pdb.gz	ENC1_HUMAN Ectoderm-neural cortex protein 1 OS=Homo sapiens OX=9606 GN=ENC1 PE=1 SV=2
3	AFDB:Q7ZT06	0.911	0.911	1.447E-90	589	0.723	0.723	Q7ZT06.pdb.gz	Q7ZT06_DANRE Ectodermal-neural cortex (With BTB-like domain) OS=Danio rerio OX=7955 GN=enc1 PE=2 SV=1
4	AFDB:O95198	0.659	0.656	2.037E-55	593	0.306	0.304	O95198.pdb.gz	KLHL2_HUMAN Kelch-like protein 2 OS=Homo sapiens OX=9606 GN=KLHL2 PE=1 SV=2
5	AFDB:Q9Y2M5	0.492	0.477	1.271E-54	609	0.317	0.307	Q9Y2M5.pdb.gz	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
6	AFDB:E0CZ16	0.479	0.481	1.567E-54	587	0.302	0.303	E0CZ16.pdb.gz	KLHL3_MOUSE Kelch-like protein 3 OS=Mus musculus OX=10090 GN=Klhl3 PE=1 SV=2
7	AFDB:Q9VUU5	0.496	0.470	3.432E-53	623	0.311	0.294	Q9VUU5.pdb.gz	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
8	AFDB:Q08BL9	0.516	0.508	5.496E-53	599	0.324	0.319	Q08BL9.pdb.gz	KL24A_DANRE Kelch-like protein 24a OS=Danio rerio OX=7955 GN=klhl24a PE=2 SV=1
9	AFDB:Q53G59	0.488	0.505	7.523E-53	568	0.292	0.303	Q53G59.pdb.gz	KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens OX=9606 GN=KLHL12 PE=1 SV=2
10	AFDB:Q96PQ7	0.480	0.380	1.831E-52	755	0.299	0.233	Q96PQ7.pdb.gz	KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens OX=9606 GN=KLHL5 PE=1 SV=3
11	PDB:5gq0A	0.395	0.666	3.751E-17	338	0.112	0.195	5gq0A.pdb.gz
12	PDB:2uvkB	0.376	0.617	3.202E-15	349	0.085	0.143	2uvkB.pdb.gz
13	PDB:5gqtA	0.372	0.460	9.606E-15	470	0.107	0.134	5gqtA.pdb.gz
14	PDB:2zwaB	0.356	0.310	1.997E-13	683	0.080	0.069	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
15	PDB:6dbjD	0.343	0.533	6.632E-9	352	0.071	0.119	6dbjD.pdb.gz	DNA melting initiates the RAG catalytic pathway.
16	PDB:6oemB	0.326	0.515	9.566E-9	346	0.066	0.113	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
17	PDB:2hqsA	0.342	0.467	2.870E-8	412	0.054	0.078	2hqsA.pdb.gz
18	PDB:6wcqC	0.188	0.808	9.072E-8	130	0.071	0.323	6wcqC.pdb.gz
19	PDB:7mq8SG	0.281	0.399	3.355E-7	389	0.066	0.100	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:1nr0A	0.265	0.257	3.725E-7	610	0.075	0.072	1nr0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14682	0.0	953	589	0.747	0.747	ENC1_HUMAN Ectoderm-neural cortex protein 1 OS=Homo sapiens OX=9606 GN=ENC1 PE=1 SV=2
2	Q2V9T0	0.0	953	589	0.745	0.745	Q2V9T0_RAT Ectodermal-neural cortex 1 OS=Rattus norvegicus OX=10116 GN=Enc1 PE=2 SV=1
3	Q6DKY8	0.0	955	589	0.747	0.747	Q6DKY8_RAT Ectodermal-neural cortex 1 OS=Rattus norvegicus OX=10116 GN=Enc1 PE=4 SV=1
4	Q7ZT06	0.0	915	589	0.723	0.723	Q7ZT06_DANRE Ectodermal-neural cortex (With BTB-like domain) OS=Danio rerio OX=7955 GN=enc1 PE=2 SV=1
5	Q8R2P1	0.0	1172	589	0.949	0.949	KLH25_MOUSE Kelch-like protein 25 OS=Mus musculus OX=10090 GN=Klhl25 PE=1 SV=1
6	Q9H0H3	0.0	1232	589	1.000	1.000	KLH25_HUMAN Kelch-like protein 25 OS=Homo sapiens OX=9606 GN=KLHL25 PE=1 SV=1
7	Q9Y2M5	1.48e-89	290	609	0.319	0.309	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
8	Q6TFL4	1.03e-88	288	600	0.319	0.313	KLH24_HUMAN Kelch-like protein 24 OS=Homo sapiens OX=9606 GN=KLHL24 PE=1 SV=1
9	Q2WGJ6	6.02e-85	278	581	0.321	0.325	KLH38_HUMAN Kelch-like protein 38 OS=Homo sapiens OX=9606 GN=KLHL38 PE=1 SV=3
10	Q08BL9	1.73e-84	277	599	0.306	0.301	KL24A_DANRE Kelch-like protein 24a OS=Danio rerio OX=7955 GN=klhl24a PE=2 SV=1
11	E0CZ16	5.66e-83	273	587	0.304	0.305	KLHL3_MOUSE Kelch-like protein 3 OS=Mus musculus OX=10090 GN=Klhl3 PE=1 SV=2
12	Q9UH77	8.09e-83	272	587	0.302	0.303	KLHL3_HUMAN Kelch-like protein 3 OS=Homo sapiens OX=9606 GN=KLHL3 PE=1 SV=2
13	Q9VUU5	4.25e-81	269	623	0.299	0.283	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
14	Q96PQ7	7.75e-81	271	755	0.295	0.230	KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens OX=9606 GN=KLHL5 PE=1 SV=3
15	Q8NBE8	1.11e-80	266	558	0.282	0.297	KLH23_HUMAN Kelch-like protein 23 OS=Homo sapiens OX=9606 GN=KLHL23 PE=1 SV=1
16	Q8JZP3	7.49e-80	265	593	0.301	0.298	KLHL2_MOUSE Kelch-like protein 2 OS=Mus musculus OX=10090 GN=Klhl2 PE=2 SV=1
17	Q5U374	2.01e-79	263	564	0.294	0.307	KLH12_DANRE Kelch-like protein 12 OS=Danio rerio OX=7955 GN=klhl12 PE=2 SV=2
18	Q53G59	3.03e-79	262	568	0.290	0.301	KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens OX=9606 GN=KLHL12 PE=1 SV=2
19	O95198	4.32e-79	263	593	0.301	0.298	KLHL2_HUMAN Kelch-like protein 2 OS=Homo sapiens OX=9606 GN=KLHL2 PE=1 SV=2
20	Q8K430	1.56e-74	251	640	0.277	0.255	KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus OX=10116 GN=Klhl17 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07707 BACK	2.1e-28	109.7	BTB And C-terminal Kelch
2	PF00651 BTB	9.1e-23	92.0	BTB/POZ domain
3	PF07893 DUF1668	8.4	17.2	Protein of unknown function (DUF1668)
4	PF01344 Kelch_1	5.7e-47	168.4	Kelch motif
5	PF07646 Kelch_2	9.5e-21	84.2	Kelch motif
6	PF13415 Kelch_3	8.8e-24	94.6	Galactose oxidase, central domain
7	PF13418 Kelch_4	4.6e-22	89.0	Galactose oxidase, central domain
8	PF13854 Kelch_5	7.1e-08	43.4	Kelch motif
9	PF13964 Kelch_6	7.8e-24	94.3	Kelch motif
10	PF06830 Root_cap	3.5e+02	12.7	Root cap
11	PF11822 SANBR_BTB	2.3	19.8	SANT and BTB domain regulator of CSR, BTB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336800

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264414	0.996	Cullin-3
2	9606.ENSP00000479101	0.966	Ectoderm-neural cortex protein 1
3	9606.ENSP00000370671	0.919	Kelch-like protein 42
4	9606.ENSP00000216225	0.914	E3 ubiquitin-protein ligase RBX1
5	9606.ENSP00000377001	0.914	Speckle-type POZ protein
6	9606.ENSP00000280098	0.913	Speckle-type POZ protein-like
7	9606.ENSP00000443191	0.913	Kelch-like protein 13
8	9606.ENSP00000351933	0.911	Kelch-like protein 9
9	9606.ENSP00000476795	0.911	Gigaxonin
10	9606.ENSP00000215739	0.910	Leucine-zipper-like transcriptional regulator 1
11	9606.ENSP00000366886	0.910	Kelch-like protein 21
12	9606.ENSP00000343273	0.904	Kelch-like protein 7
13	9606.ENSP00000226225	0.903	BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2
14	9606.ENSP00000385096	0.903	BTB/POZ domain-containing protein KCTD17
15	9606.ENSP00000209884	0.902	Kelch-like protein 20
16	9606.ENSP00000331682	0.902	Kelch-like protein 22
17	9606.ENSP00000171111	0.901	Kelch-like ECH-associated protein 1
18	9606.ENSP00000284669	0.901	Kelch-like protein 41
19	9606.ENSP00000273963	0.900	Kelch-like protein 8
20	9606.ENSP00000312397	0.900	Kelch-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030674	0.997	protein-macromolecule adaptor activity
GO:1990756	0.993	ubiquitin ligase-substrate adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0044238	0.983	primary metabolic process
GO:0071704	0.982	organic substance metabolic process
GO:0050794	0.980	regulation of cellular process
GO:0009987	0.959	cellular process
GO:0048518	0.958	positive regulation of biological process
GO:0019538	0.956	protein metabolic process
GO:0048522	0.885	positive regulation of cellular process
GO:0032446	0.777	protein modification by small protein conjugation
GO:0019222	0.759	regulation of metabolic process
GO:0016567	0.719	protein ubiquitination
GO:0080090	0.712	regulation of primary metabolic process
GO:0050863	0.649	regulation of T cell activation
GO:0044237	0.604	cellular metabolic process
GO:1903706	0.602	regulation of hemopoiesis
GO:1901565	0.585	organonitrogen compound catabolic process
GO:0060255	0.572	regulation of macromolecule metabolic process
GO:0031323	0.569	regulation of cellular metabolic process
GO:0022407	0.552	regulation of cell-cell adhesion
GO:0051603	0.552	proteolysis involved in protein catabolic process
GO:0043632	0.542	modification-dependent macromolecule catabolic process
GO:0048519	0.539	negative regulation of biological process
GO:0002684	0.534	positive regulation of immune system process
GO:1903037	0.530	regulation of leukocyte cell-cell adhesion
GO:0006511	0.527	ubiquitin-dependent protein catabolic process
GO:0048523	0.513	negative regulation of cellular process
GO:0050870	0.500	positive regulation of T cell activation
GO:1902105	0.475	regulation of leukocyte differentiation
GO:0046634	0.469	regulation of alpha-beta T cell activation
GO:0045580	0.461	regulation of T cell differentiation
GO:0046637	0.448	regulation of alpha-beta T cell differentiation
GO:1903708	0.446	positive regulation of hemopoiesis
GO:0051171	0.433	regulation of nitrogen compound metabolic process
GO:0045582	0.394	positive regulation of T cell differentiation
GO:0051246	0.312	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031463	0.999	Cul3-RING ubiquitin ligase complex
GO:0005829	0.993	cytosol
GO:0043226	0.918	organelle
GO:0043229	0.896	intracellular organelle
GO:0043227	0.848	membrane-bounded organelle
GO:0043231	0.838	intracellular membrane-bounded organelle
GO:0005634	0.668	nucleus
GO:0043233	0.515	organelle lumen
GO:0070013	0.514	intracellular organelle lumen
GO:0031981	0.491	nuclear lumen
GO:0043228	0.405	non-membrane-bounded organelle
GO:0043232	0.403	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]