StarFunc result for job id Q9H0J4

User Input

>input (1663 residues)
MKDAAEELSFARVLLQRVDELEKLFKDREQFLELVSRKLSLVPGAEEVTMVTWEELEQAI
TDGWRASQAGSETLMGFSKHGGFTSLTSPEGTLSGDSTKQPSIEQALDSASGLGPDRTAS
GSGGTAHPSDGVSSREQSKVPSGTGRQQQPRARDEAGVPRLHQSSTFQFKSDSDRHRSRE
KLTSTQPRRNARPGPVQQDLPLARDQPSSVPASQSQVHLRPDRRGLEPTGMNQPGLVPAS
TYPHGVVPLSMGQLGVPPPEMDDRELIPFVVDEQRMLPPSVPGRDQQGLELPSTDQHGLV
SVSAYQHGMTFPGTDQRSMEPLGMDQRGCVISGMGQQGLVPPGIDQQGLTLPVVDQHGLV
LPFTDQHGLVSPGLMPISADQQGFVQPSLEATGFIQPGTEQHDLIQSGRFQRALVQRGAY
QPGLVQPGADQRGLVRPGMDQSGLAQPGADQRGLVWPGMDQSGLAQPGRDQHGLIQPGTG
QHDLVQSGTGQGVLVQPGVDQPGMVQPGRFQRALVQPGAYQPGLVQPGADQIDVVQPGAD
QHGLVQSGADQSDLAQPGAVQHGLVQPGVDQRGLAQPRADHQRGLVPPGADQRGLVQPGA
DQHGLVQPGVDQHGLAQPGEVQRSLVQPGIVQRGLVQPGAVQRGLVQPGAVQRGLVQPGV
DQRGLVQPGAVQRGLVQPGAVQHGLVQPGADQRGLVQPGVDQRGLVQPGVDQRGLVQPGM
DQRGLIQPGADQPGLVQPGAGQLGMVQPGIGQQGMVQPQADPHGLVQPGAYPLGLVQPGA
YLHDLSQSGTYPRGLVQPGMDQYGLRQPGAYQPGLIAPGTKLRGSSTFQADSTGFISVRP
YQHGMVPPGREQYGQVSPLLASQGLASPGIDRRSLVPPETYQQGLMHPGTDQHSPIPLST
GLGSTHPDQQHVASPGPGEHDQVYPDAAQHGHAFSLFDSHDSMYPGYRGPGYLSADQHGQ
EGLDPNRTRASDRHGIPAQKAPGQDVTLFRSPDSVDRVLSEGSEVSSEVLSERRNSLRRM
SSSFPTAVETFHLMGELSSLYVGLKESMKDLDEEQAGQTDLEKIQFLLAQMVKRTIPPEL
QEQLKTVKTLAKEVWQEKAKVERLQRILEGEGNQEAGKELKAGELRLQLGVLRVTVADIE
KELAELRESQDRGKAAMENSVSEASLYLQDQLDKLRMIIESMLTSSSTLLSMSMAPHKAH
TLAPGQIDPEATCPACSLDVSHQVSTLVRRYEQLQDMVNSLAVSRPSKKAKLQRQDEELL
GRVQSAILQVQGDCEKLNITTSNLIEDHRQKQKDIAMLYQGLEKLEKEKANREHLEMEID
VKADKSALATKVSRVQFDATTEQLNHMMQELVAKMSGQEQDWQKMLDRLLTEMDNKLDRL
ELDPVKQLLEDRWKSLRQQLRERPPLYQADEAAAMRRQLLAHFHCLSCDRPLETPVTGHA
IPVTPAGPGLPGHHSIRPYTVFELEQVRQHSRNLKLGSAFPRGDLAQMEQSVGRLRSMHS
KMLMNIEKVQIHFGGSTKASSQIIRELLHAQCLGSPCYKRVTDMADYTYSTVPRRCGGSH
TLTYPYHRSRPQHLPRGLYPTEEIQIAMKHDEVDILGLDGHIYKGRMDTRLPGILRKDSS
GTSKRKSQQPRPHVHRPPSLSSNGQLPSRPQSAQISAGNTSER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0J4	1.000	1.000	0.000	1663	1.000	1.000	Q9H0J4.pdb.gz	QRIC2_HUMAN Glutamine-rich protein 2 OS=Homo sapiens OX=9606 GN=QRICH2 PE=1 SV=1
2	AFDB:Q8BI84	0.042	0.038	3.858E-13	1930	0.177	0.152	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
3	AFDB:Q9VQM0	0.063	0.052	5.127E-11	2162	0.171	0.132	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
4	AFDB:M9NFI9	0.046	0.039	6.405E-9	2148	0.133	0.103	M9NFI9.pdb.gz	M9NFI9_DROME Spinophilin, isoform J OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1
5	AFDB:Q4GYE7	0.068	0.069	1.834E-8	1638	0.118	0.120	Q4GYE7.pdb.gz	Q4GYE7_TRYB2 PDZ domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4310 PE=4 SV=1
6	AFDB:Q5JR59	0.055	0.064	7.159E-8	1369	0.144	0.175	Q5JR59.pdb.gz	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
7	AFDB:H2KYH3	0.046	0.034	1.250E-7	2476	0.152	0.102	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
8	AFDB:Q9ULD2	0.048	0.061	3.364E-7	1270	0.120	0.157	Q9ULD2.pdb.gz	MTUS1_HUMAN Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2
9	AFDB:Q5HZI1	0.049	0.064	3.123E-6	1210	0.117	0.160	Q5HZI1.pdb.gz	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
10	AFDB:Q9JJG0	0.046	0.063	1.379E-5	1149	0.129	0.187	Q9JJG0.pdb.gz	TACC2_MOUSE Transforming acidic coiled-coil-containing protein 2 OS=Mus musculus OX=10090 GN=Tacc2 PE=1 SV=2
11	PDB:5svaU	0.044	0.342	3.603E-1	156	0.008	0.090	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
12	PDB:7n6g3I	0.044	0.173	1.322	401	0.042	0.175	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
13	PDB:7vvuV	0.042	0.460	1.322	113	0.010	0.142	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
14	PDB:6tz402	0.048	0.308	1.693	176	0.018	0.170	6tz402.pdb.gz
15	PDB:5u0pG	0.034	0.169	1.801	194	0.020	0.170	5u0pG.pdb.gz
16	PDB:7enag	0.044	0.293	1.916	166	0.013	0.127	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
17	PDB:6wczA	0.049	0.220	2.038	350	0.019	0.089	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
18	PDB:7nvrk	0.041	0.228	2.454	133	0.009	0.113	7nvrk.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
19	PDB:5nikD	0.040	0.182	2.778	340	0.011	0.053	5nikD.pdb.gz
20	PDB:2v6l0	0.035	0.526	2.955	82	0.005	0.110	2v6l0.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V2A7	0.0	828	592	0.247	0.693	QRIC2_MOUSE Glutamine-rich protein 2 OS=Mus musculus OX=10090 GN=Qrich2 PE=2 SV=1
2	Q9H0J4	0.0	3320	1663	1.000	1.000	QRIC2_HUMAN Glutamine-rich protein 2 OS=Homo sapiens OX=9606 GN=QRICH2 PE=1 SV=1
3	Q10172	1.32e-16	89.0	1794	0.078	0.072	PAN1_SCHPO Actin cytoskeleton-regulatory complex protein pan1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pan1 PE=1 SV=1
4	Q6MX48	4.71e-13	77.0	963	0.077	0.133	Q6MX48_MYCTU PPE family protein PPE6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=PPE6 PE=3 SV=1
5	Q9VTR6	6.06e-13	77.0	1713	0.109	0.106	Q9VTR6_DROME Pericardin OS=Drosophila melanogaster OX=7227 GN=prc PE=1 SV=2
6	Q7YU48	1.62e-11	72.0	1071	0.109	0.170	Q7YU48_DROME RE39441p OS=Drosophila melanogaster OX=7227 GN=prc PE=2 SV=1
7	Q7K533	2.55e-11	70.5	456	0.041	0.151	Q7K533_DROME GH14572p OS=Drosophila melanogaster OX=7227 GN=Gbp2 PE=1 SV=1
8	Q9Y6V0	1.06e-09	66.2	5142	0.054	0.017	PCLO_HUMAN Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE=1 SV=5
9	Q9U617	1.35e-09	65.9	1729	0.094	0.090	Q9U617_DROME Pericardine OS=Drosophila melanogaster OX=7227 GN=prc PE=2 SV=1
10	Q6MWX9	4.14e-09	64.3	3157	0.038	0.020	Q6MWX9_MYCTU PPE family protein PPE55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=PPE55 PE=3 SV=1
11	Q6MWY2	4.69e-07	57.8	2523	0.028	0.019	PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=PPE54 PE=3 SV=1
12	Q79FI9	6.78e-05	50.4	1459	0.031	0.036	PPE34_MYCTU PPE family protein PPE34 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=PPE34 PE=1 SV=1
13	Q5T1M5	0.012	42.7	1219	0.031	0.043	FKB15_HUMAN FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2
14	Q8I2F2	0.018	42.0	383	0.017	0.076	Q8I2F2_PLAF7 Plasmodium RESA N-terminal domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0936800 PE=1 SV=1
15	Q12234	0.035	41.2	484	0.025	0.085	RUD3_YEAST GRIP domain-containing protein RUD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RUD3 PE=1 SV=1
16	Q63627	0.059	40.8	1200	0.013	0.018	SCAF4_RAT SR-related and CTD-associated factor 4 OS=Rattus norvegicus OX=10116 GN=Scaf4 PE=1 SV=2
17	Q384U1	0.14	39.3	507	0.041	0.136	Q384U1_TRYB2 Dynein regulatory complex protein 1/2 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5150 PE=4 SV=1
18	Q9P2E9	0.15	39.3	1410	0.032	0.038	RRBP1_HUMAN Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5
19	P9WIQ7	0.22	38.1	284	0.023	0.137	ERP_MYCTU Exported repetitive protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=erp PE=1 SV=1
20	Q7Z5P9	0.26	38.9	8384	0.024	0.005	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16043 DUF4795	4e-64	227.5	Domain of unknown function (DUF4795)
2	PF01500 Keratin_B2	1.5e+02	13.8	Keratin, high sulfur B2 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262765

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373948	0.807	Cilia- and flagella-associated protein 69
2	9606.ENSP00000349568	0.805	Cilia and flagella associated protein 43
3	9606.ENSP00000378830	0.666	Glutamine-rich protein 1
4	9606.ENSP00000405708	0.645	Coiled-coil domain-containing protein 39
5	9606.ENSP00000351327	0.632	A-kinase anchor protein 4
6	9606.ENSP00000376417	0.624	Required for sperm flagellum axoneme organization and function (By similarity). Involved in axonemal central pair complex assembly and/or stability (By similarity).
7	9606.ENSP00000377428	0.570	Cilia and flagella associated protein 44
8	9606.ENSP00000328698	0.555	Ciliary-associated calcium-binding coiled-coil protein 1
9	9606.ENSP00000316543	0.539	Ras-associated and pleckstrin homology domains-containing protein 1
10	9606.ENSP00000398211	0.525	Tetratricopeptide repeat domain containing
11	9606.ENSP00000344403	0.522	Plays a role in spermatogenesis.
12	9606.ENSP00000401514	0.506	Dynein heavy chain 1, axonemal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0030317	0.990	flagellated sperm motility
GO:0030031	0.983	cell projection assembly
GO:0031323	0.970	regulation of cellular metabolic process
GO:0051171	0.969	regulation of nitrogen compound metabolic process
GO:0080090	0.967	regulation of primary metabolic process
GO:0051246	0.952	regulation of protein metabolic process
GO:0009894	0.910	regulation of catabolic process
GO:0051248	0.910	negative regulation of protein metabolic process
GO:1903050	0.909	regulation of proteolysis involved in protein catabolic process
GO:0048523	0.870	negative regulation of cellular process
GO:0031329	0.837	regulation of cellular catabolic process
GO:0009895	0.833	negative regulation of catabolic process
GO:1903051	0.832	negative regulation of proteolysis involved in protein catabolic process
GO:0031330	0.819	negative regulation of cellular catabolic process
GO:2000058	0.818	regulation of ubiquitin-dependent protein catabolic process
GO:2000059	0.756	negative regulation of ubiquitin-dependent protein catabolic process
GO:0006996	0.329	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036126	0.996	sperm flagellum
GO:0005622	0.931	intracellular anatomical structure
GO:0043229	0.721	intracellular organelle
GO:0005737	0.627	cytoplasm
GO:0070013	0.522	intracellular organelle lumen
GO:0031981	0.510	nuclear lumen
GO:0005654	0.491	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]