StarFunc result for job id Q9H0L4

User Input

>input (616 residues)
MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYG
FCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPIIDSPYGDPID
PEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMR
IMDPEIALKILHRKIHVTPLIPGKSQSVSVSGPGPGPGPGLCPGPNVLLNQQNPPAPQPQ
HLARRPVKDIPPLMQTPIQGGIPAPGPIPAAVPGAGPGSLTPGGAMQPQLGMPGVGPVPL
ERGQVQMSDPRAPIPRGPVTPGGLPPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPPHQ
GPPMHHASGHDTRGPSSHEMRGGPLGDPRLLIGEPRGPMIDQRGLPMDGRGGRDSRAMET
RAMETEVLETRVMERRGMETCAMETRGMEARGMDARGLEMRGPVPSSRGPMTGGIQGPGP
INIGAGGPPQGPRQVPGISGVGNPGAGMQGTGIQGTGMQGAGIQGGGMQGAGIQGVSIQG
GGIQGGGIQGASKQGGSQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQ
SILILKEQIQKSTGAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C7E9	0.227	0.223	2.441E-73	632	0.911	0.888	Q8C7E9.pdb.gz	CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus OX=10090 GN=Cstf2t PE=1 SV=2
2	AFDB:P33240	0.236	0.249	3.663E-58	577	0.703	0.750	P33240.pdb.gz	CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
3	AFDB:A0A0G2K6F9	0.188	0.199	8.732E-57	575	0.677	0.725	A0A0G2K6F9.pdb.gz	A0A0G2K6F9_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=2
4	AFDB:E7EWR4	0.208	0.213	2.827E-56	597	0.709	0.732	E7EWR4.pdb.gz	E7EWR4_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
5	AFDB:Q9VE52	0.159	0.225	7.332E-28	419	0.359	0.527	Q9VE52.pdb.gz	Q9VE52_DROME Cleavage stimulation factor 64 kD subunit OS=Drosophila melanogaster OX=7227 GN=CstF64 PE=1 SV=2
6	PDB:6qx91K	0.133	0.400	1.381E-8	201	0.042	0.129	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
7	PDB:7dvqY	0.129	0.548	1.464E-8	140	0.060	0.264	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
8	AFDB:F4J5A7	0.127	0.081	1.778E-8	987	0.133	0.083	F4J5A7.pdb.gz	F4J5A7_ARATH RNA recognition motif (RRM)-containing protein OS=Arabidopsis thaliana OX=3702 GN=At3g23900 PE=1 SV=1
9	AFDB:A6NDE4	0.133	0.164	2.249E-8	496	0.135	0.167	A6NDE4.pdb.gz	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
10	PDB:3lqvB	0.124	0.613	3.533E-8	115	0.054	0.287	3lqvB.pdb.gz	Branch Recognition by SF3b14
11	PDB:5yzg1	0.124	0.310	6.741E-8	243	0.041	0.103	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
12	PDB:5gm6V	0.122	0.566	7.581E-8	128	0.052	0.250	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	AFDB:Q1LY77	0.162	0.059	1.757E-7	1844	0.153	0.051	Q1LY77.pdb.gz	SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2
14	PDB:5xjcw	0.119	0.771	1.940E-7	91	0.049	0.330	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
15	PDB:5oobB	0.132	0.498	2.602E-7	152	0.044	0.178	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
16	PDB:6y53o	0.125	0.472	2.602E-7	160	0.042	0.163	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
17	PDB:7ohxo	0.122	0.619	3.104E-7	112	0.039	0.214	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
18	PDB:6gd1A	0.120	0.380	3.491E-7	190	0.037	0.121	6gd1A.pdb.gz
19	AFDB:Q8IJI0	0.125	0.142	1.455E-6	538	0.127	0.145	Q8IJI0.pdb.gz	Q8IJI0_PLAF7 Serine/arginine-rich splicing factor 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1022400 PE=4 SV=1
20	AFDB:Q9UPS6	0.162	0.055	2.776E-6	1966	0.174	0.054	Q9UPS6.pdb.gz	SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JWP1	0.0	712	569	0.667	0.722	A0A0G2JWP1_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=2
2	A0A0G2K6F9	0.0	586	478	0.547	0.705	A0A0G2K6F9_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=2
3	A0A8I5ZY65	0.0	706	549	0.661	0.741	A0A8I5ZY65_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=1
4	A0A8J8XR33	0.0	713	624	0.687	0.678	A0A8J8XR33_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=1
5	B4F7F1	0.0	738	575	0.685	0.734	B4F7F1_RAT Cstf2 protein OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=1
6	E7EWR4	0.0	761	597	0.709	0.732	E7EWR4_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
7	P33240	0.0	773	577	0.709	0.757	CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
8	Q8C7E9	0.0	808	632	0.748	0.729	CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus OX=10090 GN=Cstf2t PE=1 SV=2
9	Q9H0L4	0.0	1203	616	1.000	1.000	CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens OX=9606 GN=CSTF2T PE=1 SV=1
10	Q9VE52	1.29e-83	270	419	0.213	0.313	Q9VE52_DROME Cleavage stimulation factor 64 kD subunit OS=Drosophila melanogaster OX=7227 GN=CstF64 PE=1 SV=2
11	O45577	9.43e-61	207	336	0.172	0.315	O45577_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cpf-2 PE=1 SV=1
12	Q9M9G6	3.06e-37	146	461	0.213	0.284	CTF64_ARATH Cleavage stimulating factor 64 OS=Arabidopsis thaliana OX=3702 GN=CSTF64 PE=1 SV=1
13	Q9P6P7	6.68e-27	115	422	0.123	0.180	YKCG_SCHPO Uncharacterized RNA-binding protein C644.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC644.16 PE=4 SV=1
14	O45713	2.98e-19	84.7	85	0.060	0.435	O45713_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rbm-3.2 PE=1 SV=1
15	O43040	7.57e-19	90.9	363	0.065	0.110	CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctf1 PE=1 SV=1
16	P25299	1.85e-16	82.4	296	0.055	0.115	RNA15_YEAST mRNA 3'-end-processing protein RNA15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RNA15 PE=1 SV=1
17	Q9VIS0	4.52e-14	72.4	154	0.058	0.234	Q9VIS0_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=cg10466 PE=4 SV=1
18	Q9Y388	5.48e-14	75.5	322	0.057	0.109	RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens OX=9606 GN=RBMX2 PE=1 SV=2
19	O94290	3.71e-13	71.2	217	0.049	0.138	IST3_SCHPO U2 snRNP component ist3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf29 PE=1 SV=1
20	Q04836	5.06e-13	72.8	329	0.057	0.106	CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP31A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14327 CSTF2_hinge	3.3e-23	93.2	Hinge domain of cleavage stimulation factor subunit 2
2	PF14304 CSTF_C	5.9e-13	59.5	Transcription termination and cleavage factor C-terminal
3	PF00076 RRM_1	1.5e-21	87.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	84	14.7	RNA recognition motif
5	PF16842 RRM_occluded	5.1e+02	12.0	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332444

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315791	0.999	Cleavage stimulation factor subunit 3
2	9606.ENSP00000217109	0.997	Cleavage stimulation factor subunit 1
3	9606.ENSP00000245934	0.988	Symplekin
4	9606.ENSP00000336752	0.988	Pre-mRNA 3'-end-processing factor FIP1
5	9606.ENSP00000238112	0.984	Cleavage and polyadenylation specificity factor subunit 3
6	9606.ENSP00000484669	0.976	Cleavage and polyadenylation specificity factor subunit 1
7	9606.ENSP00000362063	0.975	Cleavage stimulation factor subunit 2
8	9606.ENSP00000298875	0.971	Cleavage and polyadenylation specificity factor subunit 2
9	9606.ENSP00000298281	0.968	Pre-mRNA cleavage complex 2 protein Pcf11
10	9606.ENSP00000292476	0.961	Cleavage and polyadenylation specificity factor subunit 4
11	9606.ENSP00000434995	0.952	Polyribonucleotide 5'-hydroxyl-kinase Clp1
12	9606.ENSP00000325377	0.948	pre-mRNA 3' end processing protein WDR33
13	9606.ENSP00000291386	0.947	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
14	9606.ENSP00000216277	0.942	Poly(A) polymerase alpha
15	9606.ENSP00000300291	0.922	Cleavage and polyadenylation specificity factor subunit 5
16	9606.ENSP00000457723	0.872	RNA-binding protein with serine-rich domain 1
17	9606.ENSP00000216727	0.842	Polyadenylate-binding protein 2
18	9606.ENSP00000296490	0.834	WD repeat-containing protein 82
19	9606.ENSP00000343900	0.829	Putative cleavage and polyadenylation specificity factor subunit 4-like protein
20	9606.ENSP00000317872	0.825	E3 ubiquitin-protein ligase RBBP6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.978	organic substance metabolic process
GO:0044238	0.976	primary metabolic process
GO:0044237	0.976	cellular metabolic process
GO:0006807	0.968	nitrogen compound metabolic process
GO:0043170	0.956	macromolecule metabolic process
GO:0016070	0.932	RNA metabolic process
GO:0010467	0.931	gene expression
GO:0006397	0.920	mRNA processing
GO:0031124	0.840	mRNA 3'-end processing
GO:0043631	0.741	RNA polyadenylation
GO:0006378	0.489	mRNA polyadenylation
GO:0050794	0.408	regulation of cellular process
GO:0050896	0.374	response to stimulus
GO:0019222	0.306	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.889	protein-containing complex
GO:0016604	0.578	nuclear body
GO:0140513	0.444	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]