StarFunc result for job id Q9H0M0

User Input

>input (922 residues)
MATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEITKTAKSSSSS
NPKWDEQLTVNVTPQTTLEFQVWSHRTLKADALLGKATIDLKQALLIHNRKLERVKEQLK
LSLENKNGIAQTGELTVVLDGLVIEQENITNCSSSPTIEIQENGDALHENGEPSARTTAR
LAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADD
TVNGESSSFAPTDNASVTGTPVVSEENALSPNCTSTTVEDPPVQEILTSSENNECIPSTS
AELESEARSILEPDTSNSRSSSAFEAAKSRQPDGCMDPVRQQSGNANTETLPSGWEQRKD
PHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRRRVYYVDHNTRTTTWQRPTMESVRNF
EQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTK
TTQWEDPRTQGLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQ
IAYERGFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIF
RGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFI
GRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGL
EMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGF
NEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDN
EVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYK
SYEQLKEKLLFAIEETEGFGQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0M0	1.000	1.000	0.000	922	1.000	1.000	Q9H0M0.pdb.gz	WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens OX=9606 GN=WWP1 PE=1 SV=1
2	AFDB:A2A5Z6	0.395	0.481	1.146E-62	748	0.319	0.393	A2A5Z6.pdb.gz	SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus OX=10090 GN=Smurf2 PE=1 SV=1
3	AFDB:P46934	0.365	0.265	8.538E-54	1319	0.354	0.247	P46934.pdb.gz	NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens OX=9606 GN=NEDD4 PE=1 SV=4
4	AFDB:Q8IYU2	0.385	0.391	6.086E-34	909	0.169	0.172	Q8IYU2.pdb.gz	HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens OX=9606 GN=HACE1 PE=1 SV=2
5	AFDB:P51593	0.336	0.938	2.048E-33	322	0.155	0.444	P51593.pdb.gz	HUWE1_RAT E3 ubiquitin-protein ligase HUWE1 OS=Rattus norvegicus OX=10116 GN=Huwe1 PE=1 SV=3
6	PDB:7jq9A	0.379	0.146	1.379E-32	2427	0.161	0.061	7jq9A.pdb.gz
7	PDB:7mopA	0.371	0.142	7.693E-32	2445	0.162	0.061	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
8	AFDB:Q14669	0.230	0.114	1.985E-15	1992	0.130	0.060	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
9	AFDB:G5E870	0.235	0.113	3.291E-15	2025	0.123	0.056	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
10	PDB:5a50A	0.115	0.549	9.497E-8	165	0.030	0.170	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
11	AFDB:O75038	0.108	0.072	1.180E-7	1416	0.074	0.048	O75038.pdb.gz	PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens OX=9606 GN=PLCH2 PE=1 SV=3
12	PDB:4rj9A	0.118	0.572	1.286E-7	161	0.030	0.174	4rj9A.pdb.gz
13	PDB:5a52A	0.111	0.578	3.196E-7	154	0.031	0.188	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
14	AFDB:A2AP18	0.110	0.069	4.395E-7	1501	0.067	0.041	A2AP18.pdb.gz	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
15	PDB:1cjyA	0.110	0.157	7.179E-7	633	0.025	0.036	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
16	PDB:5ixcA	0.110	0.146	1.784E-6	684	0.028	0.038	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5iz5B	0.113	0.137	2.812E-6	746	0.029	0.036	5iz5B.pdb.gz
18	PDB:7lq1A	0.120	0.116	2.958E-6	950	0.021	0.020	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
19	AFDB:Q57WH0	0.109	0.083	3.158E-6	1241	0.068	0.051	Q57WH0.pdb.gz	Q57WH0_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.500 PE=4 SV=1
20	PDB:5iz5A	0.112	0.135	1.159E-5	757	0.030	0.037	5iz5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A590UJQ1	0.0	1068	900	0.582	0.597	A0A590UJQ1_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
2	A0A590UJW8	0.0	926	830	0.459	0.510	A0A590UJW8_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
3	A2VCZ7	0.0	1015	866	0.502	0.535	A2VCZ7_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=id:ibd1121 PE=1 SV=1
4	F6P346	0.0	1015	867	0.502	0.534	F6P346_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=id:ibd1121 PE=1 SV=1
5	K7WBL1	0.0	905	856	0.469	0.505	K7WBL1_9CRUS E3 ubiquitin-protein ligase OS=Artemia sinica OX=112780 PE=2 SV=1
6	O00308	0.0	1084	870	0.595	0.631	WWP2_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens OX=9606 GN=WWP2 PE=1 SV=2
7	P39940	0.0	547	809	0.299	0.341	RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSP5 PE=1 SV=1
8	Q8BZZ3	0.0	1721	918	0.906	0.910	WWP1_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Mus musculus OX=10090 GN=Wwp1 PE=1 SV=2
9	Q8C863	0.0	978	864	0.499	0.532	ITCH_MOUSE E3 ubiquitin-protein ligase Itchy OS=Mus musculus OX=10090 GN=Itch PE=1 SV=2
10	Q92462	0.0	561	767	0.325	0.391	PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub1 PE=1 SV=2
11	Q96J02	0.0	1082	903	0.601	0.614	ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=2
12	Q9DBH0	0.0	1082	870	0.593	0.629	WWP2_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus musculus OX=10090 GN=Wwp2 PE=1 SV=1
13	Q9H0M0	0.0	1929	922	1.000	1.000	WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens OX=9606 GN=WWP1 PE=1 SV=1
14	Q9N2Z7	0.0	848	794	0.422	0.490	WWP1_CAEEL E3 ubiquitin-protein ligase wwp-1 OS=Caenorhabditis elegans OX=6239 GN=wwp-1 PE=1 SV=2
15	Q9Y0H4	0.0	919	949	0.461	0.448	SUDX_DROME E3 ubiquitin-protein ligase Su(dx) OS=Drosophila melanogaster OX=7227 GN=Su(dx) PE=1 SV=1
16	U6C7R6	0.0	1055	867	0.582	0.619	U6C7R6_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=itcha PE=1 SV=1
17	Q5BDP1	3.96e-174	528	821	0.302	0.339	RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hulA PE=1 SV=1
18	O14326	3.24e-172	521	786	0.290	0.340	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1
19	D7NIW0	3.11e-169	520	968	0.295	0.281	D7NIW0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
20	A0A8I6A4L5	5.61e-169	520	976	0.295	0.279	A0A8I6A4L5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	9.1e-11	53.3	C2 domain
2	PF00632 HECT	1.6e-88	308.7	HECT-domain (ubiquitin-transferase)
3	PF00397 WW	4.4e-45	162.7	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427793

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262158	0.995	Mothers against decapentaplegic homolog 7
2	9606.ENSP00000400906	0.972	Ubiquitin-conjugating enzyme E2L 3
3	9606.ENSP00000485133	0.971	Ubiquitin-conjugating enzyme E2 that specifically acts with HECT-type and RBR family E3 ubiquitin-protein ligases. Does not function with most RING-containing E3 ubiquitin-protein ligases because it lacks intrinsic E3-independent reactivity with lysine: in contrast, it has activity with the RBR family E3 enzymes, such as PRKN and ARIH1, that function like function like RING-HECT hybrids. Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Involved in the selective degradation of short-live [...]
4	9606.ENSP00000342235	0.969	Receptor tyrosine-protein kinase erbB-4
5	9606.ENSP00000361664	0.968	Transcription factor HIVEP3
6	9606.ENSP00000264731	0.956	Tumor protein 63
7	9606.ENSP00000360493	0.948	Runt-related transcription factor 2
8	9606.ENSP00000364133	0.939	TGF-beta receptor type-1
9	9606.ENSP00000353292	0.927	Amiloride-sensitive sodium channel subunit alpha
10	9606.ENSP00000345751	0.923	Amiloride-sensitive sodium channel subunit beta
11	9606.ENSP00000300061	0.920	Amiloride-sensitive sodium channel subunit gamma
12	9606.ENSP00000414147	0.917	Spartin
13	9606.ENSP00000351905	0.911	TGF-beta receptor type-2
14	9606.ENSP00000368411	0.911	Amiloride-sensitive sodium channel subunit delta
15	9606.ENSP00000238682	0.906	Transforming growth factor beta-3
16	9606.ENSP00000384620	0.905	Pro-neuregulin-1, membrane-bound isoform
17	9606.ENSP00000221930	0.902	Transforming growth factor beta-1
18	9606.ENSP00000441543	0.878	Polyubiquitin-C
19	9606.ENSP00000366915	0.871	Krueppel-like factor 5
20	9606.ENSP00000467579	0.858	WW domain-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061630	0.432	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.980	primary metabolic process
GO:0006807	0.972	nitrogen compound metabolic process
GO:0043170	0.971	macromolecule metabolic process
GO:0050789	0.963	regulation of biological process
GO:0019538	0.957	protein metabolic process
GO:0050794	0.913	regulation of cellular process
GO:0036211	0.890	protein modification process
GO:0016567	0.869	protein ubiquitination
GO:0019222	0.816	regulation of metabolic process
GO:0060255	0.707	regulation of macromolecule metabolic process
GO:0048519	0.622	negative regulation of biological process
GO:0050896	0.603	response to stimulus
GO:0080090	0.560	regulation of primary metabolic process
GO:0051171	0.558	regulation of nitrogen compound metabolic process
GO:0044237	0.549	cellular metabolic process
GO:0048518	0.539	positive regulation of biological process
GO:0048523	0.537	negative regulation of cellular process
GO:0031323	0.499	regulation of cellular metabolic process
GO:0048522	0.444	positive regulation of cellular process
GO:0010468	0.364	regulation of gene expression
GO:0048583	0.357	regulation of response to stimulus
GO:0009889	0.351	regulation of biosynthetic process
GO:0019219	0.351	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.343	regulation of DNA-templated transcription
GO:0051179	0.334	localization
GO:0032502	0.316	developmental process
GO:0051716	0.314	cellular response to stimulus
GO:0010646	0.313	regulation of cell communication
GO:0023051	0.312	regulation of signaling
GO:0009893	0.311	positive regulation of metabolic process
GO:0048856	0.303	anatomical structure development
GO:0009892	0.301	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.996	membrane-bounded organelle
GO:0005576	0.979	extracellular region
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0031982	0.948	vesicle
GO:0005615	0.898	extracellular space
GO:0070062	0.888	extracellular exosome
GO:0005634	0.850	nucleus
GO:0031981	0.526	nuclear lumen
GO:0005654	0.498	nucleoplasm
GO:0016020	0.333	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]