StarFunc result for job id Q9H0M4

User Input

>input (648 residues)
MMTTLQNKEECGKGPKRIFAPPAQKSYSLLPCSPNSPKEETPGISSPETEARISLPKASL
KKKEEKATMKNVPSREQEKKRKAQINKQAEKKEKEKSSLTNAEFEEIVQIVLQKSLQECL
GMGSGLDFAETSCAQPVVSTQSDKEPGITASATDTDNANGEEVPHTQEISVSWEGEAAPE
IRTSKLGQPDPAPSKKKSNRLTLSKRKKEAHEKVEKTQGGHEHRQEDRLKKTVQDHSQIR
DQQKGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPE
ETWTGLESDVAYASYIPGSIIWAKQYGYPWWPGMIESDPDLGEYFLFTSHLDSLPSKYHV
TFFGETVSRAWIPVNMLKNFQELSLELSVMKKRRNDCSQKLGVALMMAQEAEQISIQERV
NLFGFWSRFNGSNSNGERKDLQLSGLNSPGSCLEKKEKEEELEKEEGEKTDPILPIRKRV
KIQTQKTKPRGLGGDAGTADGRGRTLQRKIMKRSLGRKSTAPPAPRMGRKEGQGNSDSDQ
PGPKKKFKAPQSKALAASFSEGKEVRTVPKNLGLSACKGACPSSAKEEPRHREPLTQEAG
SVPLEDEASSDLDLEQLMEDVGRELGQSGELQHSNSDGEDFPVALFGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0M4	0.999	0.999	0.000	648	1.000	1.000	Q9H0M4.pdb.gz	ZCPW1_HUMAN Zinc finger CW-type PWWP domain protein 1 OS=Homo sapiens OX=9606 GN=ZCWPW1 PE=1 SV=2
2	AFDB:Q6IR42	0.391	0.400	5.903E-57	630	0.597	0.614	Q6IR42.pdb.gz	ZCPW1_MOUSE Zinc finger CW-type PWWP domain protein 1 OS=Mus musculus OX=10090 GN=Zcwpw1 PE=1 SV=2
3	AFDB:B8JIA4	0.157	0.074	1.344E-10	1461	0.190	0.084	B8JIA4.pdb.gz	B8JIA4_DANRE Histone-lysine N-methyltransferase NSD2 OS=Danio rerio OX=7955 GN=fc12c04 PE=1 SV=1
4	AFDB:Q96L73	0.134	0.036	1.524E-7	2696	0.184	0.044	Q96L73.pdb.gz	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
5	PDB:6s01K	0.111	0.688	1.468E-3	86	0.032	0.244	6s01K.pdb.gz	Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
6	AFDB:Q69Z61	0.121	0.108	1.624E-2	730	0.111	0.099	Q69Z61.pdb.gz	PWP2A_MOUSE PWWP domain-containing protein 2A OS=Mus musculus OX=10090 GN=Pwwp2a PE=2 SV=2
7	PDB:4v8mBa	0.085	0.332	2.005E-2	132	0.022	0.106	4v8mBa.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
8	AFDB:Q2LAE1	0.078	0.037	2.083E-2	1759	0.147	0.054	Q2LAE1.pdb.gz	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
9	PDB:3mp8A	0.072	0.089	5.777E-2	513	0.014	0.018	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
10	PDB:3j791	0.069	0.242	7.886E-2	140	0.020	0.093	3j791.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
11	PDB:7xe1A	0.067	0.059	7.886E-2	751	0.026	0.023	7xe1A.pdb.gz	Structure-Activity Relationship and In Silico Evaluation of cis- and trans-PCPA-Derived Inhibitors of LSD1 and LSD2
12	PDB:4v6iBN	0.073	0.277	8.392E-2	138	0.029	0.138	4v6iBN.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
13	PDB:7pzyn	0.081	0.266	1.076E-1	155	0.034	0.142	7pzyn.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
14	AFDB:Q5H9N3	0.062	0.053	1.729E-1	823	0.127	0.100	Q5H9N3.pdb.gz	NFI1_CAEEL Nuclear factor I family protein OS=Caenorhabditis elegans OX=6239 GN=nfi-1 PE=2 SV=1
15	PDB:7cpuLZ	0.081	0.314	1.771E-1	135	0.025	0.119	7cpuLZ.pdb.gz	A male germ-cell-specific ribosome controls male fertility.
16	AFDB:Q50360	0.063	0.061	1.840E-1	672	0.120	0.116	Q50360.pdb.gz	HMW3_MYCPN Cytadherence high molecular weight protein 3 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=hmw3 PE=1 SV=1
17	PDB:4v6iBU	0.070	0.237	1.885E-1	160	0.035	0.144	4v6iBU.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
18	AFDB:Q9UU99	0.056	0.040	1.958E-1	1008	0.156	0.100	Q9UU99.pdb.gz	YJX4_SCHPO CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC23B6.04c PE=1 SV=1
19	AFDB:Q9W1N8	0.051	0.041	2.360E-1	941	0.157	0.108	Q9W1N8.pdb.gz	Q9W1N8_DROME LD45221p OS=Drosophila melanogaster OX=7227 GN=mi PE=2 SV=2
20	PDB:5datl6	0.078	0.246	3.101E-1	157	0.026	0.108	5datl6.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5E1	0.0	726	404	0.542	0.869	A0A0S2Z5E1_HUMAN Zinc finger CW type with PWWP domain 1 isoform 4 OS=Homo sapiens OX=9606 GN=ZCWPW1 PE=1 SV=1
2	A0A0S2Z6A9	0.0	661	376	0.500	0.862	A0A0S2Z6A9_HUMAN Zinc finger CW type with PWWP domain 1 isoform 6 OS=Homo sapiens OX=9606 GN=ZCWPW1 PE=1 SV=1
3	Q6IR42	0.0	635	630	0.593	0.610	ZCPW1_MOUSE Zinc finger CW-type PWWP domain protein 1 OS=Mus musculus OX=10090 GN=Zcwpw1 PE=1 SV=2
4	Q9H0M4	0.0	1332	648	1.000	1.000	ZCPW1_HUMAN Zinc finger CW-type PWWP domain protein 1 OS=Homo sapiens OX=9606 GN=ZCWPW1 PE=1 SV=2
5	Q504Y3	2.06e-14	77.4	356	0.069	0.126	ZCPW2_HUMAN Zinc finger CW-type PWWP domain protein 2 OS=Homo sapiens OX=9606 GN=ZCWPW2 PE=1 SV=1
6	B8JIA4	5.66e-11	68.6	1461	0.066	0.029	B8JIA4_DANRE Histone-lysine N-methyltransferase NSD2 OS=Danio rerio OX=7955 GN=fc12c04 PE=1 SV=1
7	D6R9V2	1.63e-10	65.9	392	0.060	0.099	D6R9V2_HUMAN Nuclear receptor binding SET domain protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
8	O96028	2.60e-10	66.2	1365	0.060	0.029	NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
9	Q8BVE8	3.41e-10	65.9	1365	0.065	0.031	NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus OX=10090 GN=Nsd2 PE=1 SV=2
10	Q8TE76	7.40e-09	61.6	937	0.039	0.027	MORC4_HUMAN MORC family CW-type zinc finger protein 4 OS=Homo sapiens OX=9606 GN=MORC4 PE=1 SV=2
11	A0A1W2Q695	2.41e-07	56.6	1361	0.034	0.016	A0A1W2Q695_RAT DNA mismatch repair protein OS=Rattus norvegicus OX=10116 GN=Msh6 PE=1 SV=2
12	D4A0U9	3.84e-07	55.8	1336	0.034	0.016	D4A0U9_RAT DNA mismatch repair protein OS=Rattus norvegicus OX=10116 GN=Msh6 PE=1 SV=4
13	P54276	9.27e-07	54.7	1358	0.034	0.016	MSH6_MOUSE DNA mismatch repair protein Msh6 OS=Mus musculus OX=10090 GN=Msh6 PE=1 SV=3
14	Q6P2L6	1.06e-06	54.7	1439	0.060	0.027	NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus OX=10090 GN=Nsd3 PE=1 SV=2
15	E1BYJ2	1.52e-06	53.9	1337	0.034	0.016	MSH6_CHICK DNA mismatch repair protein Msh6 OS=Gallus gallus OX=9031 GN=MSH6 PE=3 SV=2
16	P52701	1.61e-06	53.9	1360	0.040	0.019	MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2
17	Q9BZ95	3.14e-06	53.1	1437	0.051	0.023	NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3 PE=1 SV=1
18	Q803S7	3.79e-05	49.7	1369	0.032	0.015	Q803S7_DANRE DNA mismatch repair protein OS=Danio rerio OX=7955 GN=wu:fb36c12 PE=1 SV=1
19	Q8MT36	4.15e-05	49.3	1427	0.049	0.022	NSD_DROME Nuclear receptor binding SET domain protein OS=Drosophila melanogaster OX=7227 GN=NSD PE=1 SV=2
20	Q96L73	1.63e-04	47.8	2696	0.040	0.010	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03021 CM2	5.5e+02	11.8	Influenza C virus M2 protein
2	PF00855 PWWP	3.9e-13	61.0	PWWP domain
3	PF07496 zf-CW	2e-10	51.8	CW-type Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381109

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000199447	0.825	Thioredoxin domain-containing protein 3
2	9606.ENSP00000353462	0.819	Cas scaffolding protein family member 4
3	9606.ENSP00000342858	0.759	Fermitin family homolog 2
4	9606.ENSP00000431840	0.757	Sodium/potassium/calcium exchanger 4
5	9606.ENSP00000263094	0.755	ATP-binding cassette sub-family A member 7
6	9606.ENSP00000216487	0.749	Ras and Rab interactor 3
7	9606.ENSP00000435926	0.735	CUGBP Elav-like family member 1
8	9606.ENSP00000377015	0.715	Phosphatidylinositol-binding clathrin assembly protein
9	9606.ENSP00000392770	0.715	Membrane-spanning 4-domains subfamily A member 6A
10	9606.ENSP00000260197	0.710	Sortilin-related receptor
11	9606.ENSP00000316779	0.710	Myc box-dependent-interacting protein 1
12	9606.ENSP00000364114	0.710	HLA class II histocompatibility antigen, DR beta 5 chain
13	9606.ENSP00000352264	0.703	CD2-associated protein
14	9606.ENSP00000405338	0.688	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
15	9606.ENSP00000380638	0.681	Protein-tyrosine kinase 2-beta
16	9606.ENSP00000410764	0.669	annotation not available
17	9606.ENSP00000275815	0.665	Ephrin type-A receptor 1
18	9606.ENSP00000391748	0.662	Paired immunoglobin-like type 2 receptor beta
19	9606.ENSP00000315130	0.658	Clusterin
20	9606.ENSP00000340874	0.654	Myocyte-specific enhancer factor 2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	0.998	methylated histone binding
GO:0003677	0.995	DNA binding
GO:1901265	0.917	nucleoside phosphate binding
GO:0008327	0.905	methyl-CpG binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050789	0.995	regulation of biological process
GO:0050794	0.989	regulation of cellular process
GO:0032502	0.987	developmental process
GO:0016043	0.981	cellular component organization
GO:0048518	0.976	positive regulation of biological process
GO:0019222	0.973	regulation of metabolic process
GO:0048583	0.963	regulation of response to stimulus
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0032501	0.954	multicellular organismal process
GO:0048522	0.940	positive regulation of cellular process
GO:0080090	0.932	regulation of primary metabolic process
GO:0051171	0.932	regulation of nitrogen compound metabolic process
GO:0051173	0.919	positive regulation of nitrogen compound metabolic process
GO:0031325	0.919	positive regulation of cellular metabolic process
GO:0010604	0.916	positive regulation of macromolecule metabolic process
GO:0019219	0.895	regulation of nucleobase-containing compound metabolic process
GO:0048584	0.887	positive regulation of response to stimulus
GO:0045935	0.865	positive regulation of nucleobase-containing compound metabolic process
GO:0006996	0.798	organelle organization
GO:0022414	0.786	reproductive process
GO:0051052	0.669	regulation of DNA metabolic process
GO:0051321	0.647	meiotic cell cycle
GO:0048285	0.640	organelle fission
GO:0000018	0.633	regulation of DNA recombination
GO:1903046	0.618	meiotic cell cycle process
GO:0071704	0.609	organic substance metabolic process
GO:0140013	0.577	meiotic nuclear division
GO:0080134	0.553	regulation of response to stress
GO:0044238	0.549	primary metabolic process
GO:0044237	0.532	cellular metabolic process
GO:0032504	0.532	multicellular organism reproduction
GO:0006807	0.498	nitrogen compound metabolic process
GO:0043170	0.495	macromolecule metabolic process
GO:0050896	0.475	response to stimulus
GO:0061982	0.348	meiosis I cell cycle process
GO:0080135	0.346	regulation of cellular response to stress
GO:2001020	0.342	regulation of response to DNA damage stimulus
GO:0006282	0.324	regulation of DNA repair
GO:0010468	0.322	regulation of gene expression
GO:0048609	0.321	multicellular organismal reproductive process
GO:0051716	0.320	cellular response to stimulus
GO:0019953	0.319	sexual reproduction
GO:0051054	0.317	positive regulation of DNA metabolic process
GO:0007276	0.314	gamete generation
GO:2001022	0.307	positive regulation of response to DNA damage stimulus
GO:2000779	0.307	regulation of double-strand break repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005694	0.962	chromosome
GO:0000803	0.911	sex chromosome
GO:0005737	0.910	cytoplasm
GO:0070013	0.873	intracellular organelle lumen
GO:0031981	0.825	nuclear lumen
GO:0001741	0.757	XY body
GO:0016020	0.713	membrane
GO:0005654	0.677	nucleoplasm
GO:0005886	0.377	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]