StarFunc result for job id Q9H0N5

User Input

>input (130 residues)
MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDA
IYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLA
KFIEKAAASV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0N5	1.000	1.000	1.205E-23	130	1.000	1.000	Q9H0N5.pdb.gz	PHS2_HUMAN Pterin-4-alpha-carbinolamine dehydratase 2 OS=Homo sapiens OX=9606 GN=PCBD2 PE=1 SV=4
2	AFDB:Q9CZL5	0.776	0.743	1.897E-17	136	0.785	0.750	Q9CZL5.pdb.gz	PHS2_MOUSE Pterin-4-alpha-carbinolamine dehydratase 2 OS=Mus musculus OX=10090 GN=Pcbd2 PE=1 SV=2
3	PDB:1f93A	0.732	0.919	6.227E-14	103	0.477	0.602	1f93A.pdb.gz	Structural basis of dimerization, coactivator recognition and MODY3 mutations in HNF-1alpha.
4	AFDB:P61457	0.726	0.903	2.517E-13	104	0.477	0.596	P61457.pdb.gz	PHS_HUMAN Pterin-4-alpha-carbinolamine dehydratase OS=Homo sapiens OX=9606 GN=PCBD1 PE=1 SV=2
5	AFDB:O42658	0.655	0.872	3.256E-10	96	0.346	0.469	O42658.pdb.gz	PHS_SCHPO Pterin-4-alpha-carbinolamine dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omt2 PE=3 SV=1
6	AFDB:Q384W7	0.692	0.724	2.777E-9	124	0.262	0.274	Q384W7.pdb.gz	Q384W7_TRYB2 4a-hydroxytetrahydrobiopterin dehydratase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4890 PE=3 SV=1
7	AFDB:Q5ACY8	0.652	0.737	8.573E-8	114	0.231	0.263	Q5ACY8.pdb.gz	Q5ACY8_CANAL 4a-hydroxytetrahydrobiopterin dehydratase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHHB PE=3 SV=1
8	AFDB:Q6QJ72	0.596	0.430	3.102E-7	187	0.254	0.176	Q6QJ72.pdb.gz	PDL2_ARATH Pterin-4-alpha-carbinolamine dehydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDL2 PE=1 SV=1
9	AFDB:P38744	0.678	0.733	3.594E-6	120	0.185	0.200	P38744.pdb.gz	PHS_YEAST Putative pterin-4-alpha-carbinolamine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHL018W PE=1 SV=1
10	AFDB:Q9LU63	0.578	0.361	9.231E-5	220	0.154	0.091	Q9LU63.pdb.gz	ATP1_ARATH Probable pterin-4-alpha-carbinolamine dehydratase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATP1 PE=1 SV=1
11	AFDB:Q57TV8	0.482	0.239	1.285E-3	273	0.154	0.073	Q57TV8.pdb.gz	Q57TV8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.320 PE=4 SV=1
12	PDB:7a67A	0.352	0.516	8.900E-2	80	0.054	0.087	7a67A.pdb.gz
13	PDB:4wx8B	0.292	0.421	1.285E-1	84	0.069	0.107	4wx8B.pdb.gz
14	PDB:7o9mf	0.298	0.298	2.230E-1	130	0.100	0.100	7o9mf.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
15	PDB:6w17D	0.249	0.145	3.870E-1	301	0.100	0.043	6w17D.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
16	PDB:6gwjB	0.318	0.449	4.115E-1	84	0.031	0.048	6gwjB.pdb.gz	Defects in t 6 A tRNA modification due to GON7 and YRDC mutations lead to Galloway-Mowat syndrome.
17	PDB:3kxyA	0.251	0.248	4.945E-1	133	0.108	0.105	3kxyA.pdb.gz
18	PDB:7bfqB	0.220	0.081	4.945E-1	590	0.177	0.039	7bfqB.pdb.gz
19	PDB:1umgA	0.335	0.147	5.257E-1	359	0.115	0.042	1umgA.pdb.gz	The first crystal structure of the novel class of fructose-1,6-bisphosphatase present in thermophilic archaea.
20	PDB:2j0wA	0.290	0.098	5.589E-1	447	0.062	0.018	2j0wA.pdb.gz	Structures of R- and T-State Escherichia Coli Aspartokinase III: Mechanisms of the Allosteric Transition and Inhibition by Lysine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H0N5	1.01e-93	268	130	1.000	1.000	PHS2_HUMAN Pterin-4-alpha-carbinolamine dehydratase 2 OS=Homo sapiens OX=9606 GN=PCBD2 PE=1 SV=4
2	Q9CZL5	1.40e-66	199	136	0.754	0.721	PHS2_MOUSE Pterin-4-alpha-carbinolamine dehydratase 2 OS=Mus musculus OX=10090 GN=Pcbd2 PE=1 SV=2
3	P61457	8.91e-47	148	104	0.485	0.606	PHS_HUMAN Pterin-4-alpha-carbinolamine dehydratase OS=Homo sapiens OX=9606 GN=PCBD1 PE=1 SV=2
4	P61459	8.91e-47	148	104	0.485	0.606	PHS_RAT Pterin-4-alpha-carbinolamine dehydratase OS=Rattus norvegicus OX=10116 GN=Pcbd1 PE=1 SV=2
5	P61458	2.44e-46	147	104	0.477	0.596	PHS_MOUSE Pterin-4-alpha-carbinolamine dehydratase OS=Mus musculus OX=10090 GN=Pcbd1 PE=1 SV=2
6	O42658	1.16e-25	94.7	96	0.323	0.438	PHS_SCHPO Pterin-4-alpha-carbinolamine dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omt2 PE=3 SV=1
7	Q384W7	1.89e-15	69.3	124	0.315	0.331	Q384W7_TRYB2 4a-hydroxytetrahydrobiopterin dehydratase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4890 PE=3 SV=1
8	Q5ACY8	1.08e-06	46.2	114	0.277	0.316	Q5ACY8_CANAL 4a-hydroxytetrahydrobiopterin dehydratase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHHB PE=3 SV=1
9	Q6QJ72	3.79e-06	46.2	187	0.238	0.166	PDL2_ARATH Pterin-4-alpha-carbinolamine dehydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDL2 PE=1 SV=1
10	P38744	2.50e-05	42.7	120	0.154	0.167	PHS_YEAST Putative pterin-4-alpha-carbinolamine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHL018W PE=1 SV=1
11	Q93ZH9	0.007	37.4	332	0.177	0.069	HHP1_ARATH Heptahelical transmembrane protein 1 OS=Arabidopsis thaliana OX=3702 GN=HHP1 PE=1 SV=1
12	Q90Y37	1.3	30.8	1375	0.146	0.014	Q90Y37_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock2 PE=1 SV=1
13	A0A1D8PHH2	1.9	30.4	983	0.131	0.017	A0A1D8PHH2_CANAL Png2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PNG2 PE=4 SV=1
14	Q8C8R3	5.0	29.3	3898	0.131	0.004	ANK2_MOUSE Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2
15	Q32Q89	7.1	28.5	427	0.131	0.040	Q32Q89_RAT Fgl2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Fgl2 PE=2 SV=1
16	G3V7P2	7.2	28.5	429	0.131	0.040	G3V7P2_RAT Fibrinogen-like 2 OS=Rattus norvegicus OX=10116 GN=Fgl2 PE=4 SV=1
17	Q6IN12	7.2	28.5	419	0.131	0.041	Q6IN12_RAT Fgl2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Fgl2 PE=2 SV=1
18	Q5U3X5	7.4	28.5	422	0.131	0.040	Q5U3X5_RAT Fgl2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Fgl2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01329 Pterin_4a	1.6e-28	110.0	Pterin 4 alpha carbinolamine dehydratase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421544

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281243	0.959	Dihydropteridine reductase
2	9606.ENSP00000257555	0.949	Hepatocyte nuclear factor 1-alpha
3	9606.ENSP00000469863	0.927	Dual specificity tyrosine-phosphorylation-regulated kinase 1B
4	9606.ENSP00000329093	0.926	Tryptophan hydroxylase 2
5	9606.ENSP00000250018	0.924	Belongs to the biopterin-dependent aromatic amino acid hydroxylase family
6	9606.ENSP00000370571	0.924	Tyrosine 3-monooxygenase
7	9606.ENSP00000448059	0.924	Catalyzes the hydroxylation of L-phenylalanine to L-tyrosine.
8	9606.ENSP00000282611	0.906	Cation channel sperm-associated protein 3
9	9606.ENSP00000299299	0.881	Pterin-4-alpha-carbinolamine dehydratase
10	9606.ENSP00000385019	0.641	Voltage-dependent T-type calcium channel subunit alpha-1I
11	9606.ENSP00000351157	0.640	Acts as a positive regulator of ciliary hedgehog signaling (By similarity). Involved in ciliogenesis .
12	9606.ENSP00000265340	0.598	Pituitary homeobox 1
13	9606.ENSP00000341662	0.572	Alkylglycerol monooxygenase
14	9606.ENSP00000260447	0.567	GTP cyclohydrolase 1 feedback regulatory protein
15	9606.ENSP00000381932	0.525	Dual specificity tyrosine-phosphorylation-regulated kinase 1A
16	9606.ENSP00000261531	0.520	SNW domain-containing protein 1
17	9606.ENSP00000392678	0.517	Functions as signal transducer for MSTN during skeletal muscle regeneration and myogenesis. May regulate chemotaxis of both macrophages and myoblasts by reorganising actin cytoskeleton, leading to more efficient lamellipodia formation via a PI3 kinase dependent pathway

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.992	catalytic activity
GO:0042802	0.741	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.975	biological regulation
GO:0045893	0.958	positive regulation of DNA-templated transcription
GO:0009987	0.801	cellular process
GO:0008152	0.794	metabolic process
GO:0044237	0.776	cellular metabolic process
GO:0071704	0.736	organic substance metabolic process
GO:0006807	0.682	nitrogen compound metabolic process
GO:1901564	0.582	organonitrogen compound metabolic process
GO:0044281	0.496	small molecule metabolic process
GO:1901360	0.496	organic cyclic compound metabolic process
GO:0044238	0.493	primary metabolic process
GO:0006725	0.487	cellular aromatic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0005739	0.990	mitochondrion
GO:0070013	0.411	intracellular organelle lumen
GO:0031981	0.316	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]