StarFunc result for job id Q9H0P0

User Input

>input (336 residues)
MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSV
RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDEC
RKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVM
LKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLK
GFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYL
NDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0P0	1.000	1.000	2.026E-65	336	1.000	1.000	Q9H0P0.pdb.gz	5NT3A_HUMAN Cytosolic 5'-nucleotidase 3A OS=Homo sapiens OX=9606 GN=NT5C3A PE=1 SV=3
2	AFDB:Q969T7	0.833	0.932	2.663E-43	300	0.485	0.543	Q969T7.pdb.gz	5NT3B_HUMAN 7-methylguanosine phosphate-specific 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C3B PE=1 SV=4
3	PDB:7zeeA	0.746	0.880	2.115E-37	282	0.467	0.557	7zeeA.pdb.gz	Substrate-Based Design of Cytosolic Nucleotidase IIIB Inhibitors and Structural Insights into Inhibition Mechanism.
4	AFDB:Q9W197	0.768	0.807	4.794E-31	319	0.327	0.345	Q9W197.pdb.gz	5NT3B_DROME 7-methylguanosine phosphate-specific 5'-nucleotidase OS=Drosophila melanogaster OX=7227 GN=cN-IIIB PE=1 SV=1
5	PDB:4nv0B	0.754	0.839	6.976E-28	300	0.327	0.367	4nv0B.pdb.gz	Crystal Structures of the Novel Cytosolic 5'-Nucleotidase IIIB Explain Its Preference for m7GMP
6	AFDB:Q6FND4	0.467	0.522	1.147E-9	295	0.146	0.166	Q6FND4.pdb.gz	Q6FND4_CANGA phosphoserine phosphatase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SER2 PE=3 SV=1
7	AFDB:P42941	0.460	0.494	2.268E-9	309	0.125	0.136	P42941.pdb.gz	SERB_YEAST Phosphoserine phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SER2 PE=1 SV=1
8	PDB:5it0A	0.464	0.404	2.302E-9	396	0.110	0.093	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
9	AFDB:P78330	0.486	0.678	5.314E-9	225	0.122	0.182	P78330.pdb.gz	SERB_HUMAN Phosphoserine phosphatase OS=Homo sapiens OX=9606 GN=PSPH PE=1 SV=2
10	AFDB:O53289	0.481	0.406	7.908E-9	409	0.119	0.098	O53289.pdb.gz	SERB2_MYCTU Phosphoserine phosphatase SerB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=serB2 PE=1 SV=1
11	AFDB:A0QJI1	0.472	0.396	1.177E-8	411	0.119	0.097	A0QJI1.pdb.gz	SERB_MYCA1 Phosphoserine phosphatase OS=Mycobacterium avium (strain 104) OX=243243 GN=serB PE=1 SV=1
12	AFDB:Q9VSY6	0.470	0.563	1.654E-8	270	0.113	0.141	Q9VSY6.pdb.gz	SERB_DROME Phosphoserine phosphatase OS=Drosophila melanogaster OX=7227 GN=aay PE=2 SV=1
13	AFDB:P0AGB0	0.469	0.486	1.962E-8	322	0.107	0.112	P0AGB0.pdb.gz	SERB_ECOLI Phosphoserine phosphatase OS=Escherichia coli (strain K12) OX=83333 GN=serB PE=1 SV=1
14	PDB:6hyjB	0.455	0.637	2.645E-8	223	0.122	0.184	6hyjB.pdb.gz	Crystal structures and snapshots along the reaction pathway of human phosphoserine phosphatase.
15	PDB:1rkuA	0.409	0.611	2.629E-6	206	0.101	0.165	1rkuA.pdb.gz	The thrH Gene Product of Pseudomonas aeruginosa Is a Dual Activity Enzyme with a Novel Phosphoserine:Homoserine Phosphotransferase Activity.
16	PDB:4uauA	0.337	0.465	5.467E-4	226	0.110	0.164	4uauA.pdb.gz	Degradation of potent Rubisco inhibitor by selective sugar phosphatase.
17	PDB:3l5kA	0.353	0.471	8.610E-4	233	0.101	0.146	3l5kA.pdb.gz
18	PDB:1ynsA	0.330	0.413	1.906E-3	254	0.092	0.122	1ynsA.pdb.gz	Crystal structure of human e1 enzyme and its complex with a substrate analog reveals the mechanism of its phosphatase/enolase
19	PDB:4bbjA	0.370	0.207	2.018E-3	664	0.122	0.062	4bbjA.pdb.gz	Copper-Transporting P-Type Atpases Use a Unique Ion-Release Pathway
20	PDB:1te2A	0.342	0.477	2.837E-3	218	0.089	0.138	1te2A.pdb.gz	Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A090N7U2	0.0	589	285	0.848	1.000	A0A090N7U2_HUMAN 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C3 PE=3 SV=1
2	A0A0G2K097	0.0	550	288	0.786	0.917	A0A0G2K097_RAT 5'-nucleotidase OS=Rattus norvegicus OX=10116 GN=Nt5c3a PE=1 SV=1
3	A0A8I6AHB0	0.0	617	331	0.923	0.937	A0A8I6AHB0_RAT 5'-nucleotidase OS=Rattus norvegicus OX=10116 GN=Nt5c3a PE=3 SV=1
4	Q9D020	0.0	617	331	0.923	0.937	5NT3A_MOUSE Cytosolic 5'-nucleotidase 3A OS=Mus musculus OX=10090 GN=Nt5c3a PE=1 SV=4
5	Q9H0P0	0.0	692	336	1.000	1.000	5NT3A_HUMAN Cytosolic 5'-nucleotidase 3A OS=Homo sapiens OX=9606 GN=NT5C3A PE=1 SV=3
6	X6RM59	0.0	682	331	0.985	1.000	X6RM59_HUMAN 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C3A PE=1 SV=1
7	Q969T7	1.63e-126	366	300	0.491	0.550	5NT3B_HUMAN 7-methylguanosine phosphate-specific 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C3B PE=1 SV=4
8	Q9W197	3.57e-69	220	319	0.333	0.351	5NT3B_DROME 7-methylguanosine phosphate-specific 5'-nucleotidase OS=Drosophila melanogaster OX=7227 GN=cN-IIIB PE=1 SV=1
9	Q99LS3	0.13	35.8	225	0.074	0.111	SERB_MOUSE Phosphoserine phosphatase OS=Mus musculus OX=10090 GN=Psph PE=1 SV=1
10	Q5M819	0.18	35.4	225	0.089	0.133	SERB_RAT Phosphoserine phosphatase OS=Rattus norvegicus OX=10116 GN=Psph PE=2 SV=1
11	P78330	0.22	35.0	225	0.057	0.084	SERB_HUMAN Phosphoserine phosphatase OS=Homo sapiens OX=9606 GN=PSPH PE=1 SV=2
12	D4A2Y9	1.7	32.7	403	0.054	0.045	PEX13_RAT Peroxisomal membrane protein PEX13 OS=Rattus norvegicus OX=10116 GN=Pex13 PE=1 SV=3
13	F1QTJ4	2.5	32.7	1615	0.083	0.017	F1QTJ4_DANRE Low density lipoprotein receptor-related protein 5 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
14	P74285	5.4	31.2	388	0.086	0.075	CUGP_SYNY3 UTP--glucose-1-phosphate uridylyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=cugP PE=1 SV=1
15	Q06156	5.9	31.6	1176	0.060	0.017	CND1_YEAST Condensin complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCS4 PE=1 SV=1
16	Q32PN7	6.8	31.2	756	0.030	0.013	DZI1L_DANRE Cilium assembly protein DZIP1L OS=Danio rerio OX=7955 GN=dzip1l PE=2 SV=1
17	Q9W3N0	8.5	30.8	1117	0.092	0.028	Q9W3N0_DROME FI21262p1 OS=Drosophila melanogaster OX=7227 GN=snz PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13840 ACT_7	20	16.4	ACT domain
2	PF02017 CIDE-N	93	14.5	CIDE-N domain
3	PF11377 DUF3180	84	14.8	Protein of unknown function (DUF3180)
4	PF12710 HAD	2.2	20.2	haloacid dehalogenase-like hydrolase
5	PF03031 NIF	90	14.3	NLI interacting factor-like phosphatase
6	PF05822 UMPH-1	2.3e-114	392.6	Pyrimidine 5'-nucleotidase (UMPH-1)
7	PF12861 zf-ANAPC11	48	15.4	Anaphase-promoting complex subunit 11 RING-H2 finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000018709

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000008071	0.986	Adenosine deaminase
2	61853.ENSNLEP00000008340	0.953	Thymidylate synthetase
3	61853.ENSNLEP00000000792	0.941	Uridine monophosphate synthetase
4	61853.ENSNLEP00000000697	0.936	5', 3'-nucleotidase, cytosolic
5	61853.ENSNLEP00000009395	0.929	Deoxycytidine kinase
6	61853.ENSNLEP00000001235	0.925	GMP reductase
7	61853.ENSNLEP00000009443	0.924	Deoxythymidylate kinase (thymidylate kinase)
8	61853.ENSNLEP00000013361	0.922	Purine nucleoside phosphorylase
9	61853.ENSNLEP00000004717	0.916	Guanine monphosphate synthase
10	61853.ENSNLEP00000018620	0.916	Adenylosuccinate lyase
11	61853.ENSNLEP00000018947	0.910	Adenine phosphoribosyltransferase
12	61853.ENSNLEP00000010830	0.908	GTP:AMP phosphotransferase AK3, mitochondrial
13	61853.ENSNLEP00000009656	0.906	Cytidine deaminase
14	61853.ENSNLEP00000012909	0.906	dCMP deaminase
15	61853.ENSNLEP00000003397	0.905	Nudix hydrolase 16
16	61853.ENSNLEP00000008217	0.903	Inosine-5'-monophosphate dehydrogenase
17	61853.ENSNLEP00000002427	0.902	Hypoxanthine phosphoribosyltransferase 1
18	61853.ENSNLEP00000008808	0.902	5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
19	61853.ENSNLEP00000020440	0.901	Adenosine kinase
20	61853.ENSNLEP00000001093	0.900	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008253	0.999	5'-nucleotidase activity
GO:0005515	0.990	protein binding
GO:0016740	0.857	transferase activity
GO:0016772	0.767	transferase activity, transferring phosphorus-containing groups
GO:0140101	0.668	catalytic activity, acting on a tRNA
GO:0016773	0.606	phosphotransferase activity, alcohol group as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0044281	0.991	small molecule metabolic process
GO:0046483	0.991	heterocycle metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:1901135	0.989	carbohydrate derivative metabolic process
GO:1901360	0.986	organic cyclic compound metabolic process
GO:0006725	0.985	cellular aromatic compound metabolic process
GO:0006139	0.979	nucleobase-containing compound metabolic process
GO:0055086	0.958	nucleobase-containing small molecule metabolic process
GO:1901564	0.944	organonitrogen compound metabolic process
GO:0072521	0.630	purine-containing compound metabolic process
GO:0050896	0.544	response to stimulus
GO:1901657	0.534	glycosyl compound metabolic process
GO:0009119	0.488	ribonucleoside metabolic process
GO:0006793	0.481	phosphorus metabolic process
GO:0019637	0.453	organophosphate metabolic process
GO:0006796	0.450	phosphate-containing compound metabolic process
GO:0046700	0.445	heterocycle catabolic process
GO:0044270	0.445	cellular nitrogen compound catabolic process
GO:0034655	0.444	nucleobase-containing compound catabolic process
GO:0006753	0.381	nucleoside phosphate metabolic process
GO:0009117	0.354	nucleotide metabolic process
GO:0046128	0.322	purine ribonucleoside metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.996	nucleoplasm
GO:0005783	0.968	endoplasmic reticulum
GO:0016604	0.962	nuclear body
GO:0005739	0.350	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12484	0.999	a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate
EC:3.1.3.5	0.999	5'-nucleotidase.
EC:2.-.-.-	0.857	Transferases.
EC:2.7.-.-	0.767	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.606	Phosphotransferases with an alcohol group as acceptor.

[back to server]