StarFunc result for job id Q9H0R5

User Input

>input (595 residues)
MAPEIHMTGPMCLIENTNGELVANPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KNKGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDVKKGDNQNDSWIFTLAV
LLSSTLVYNSMGTINQQAMDQLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTL
RDFSLDLEADGQPLTPDEYLEYSLKLTQGTSQKDKNFNLPRLCIRKFFPKKKCFVFDLPI
HRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIKVNGPRLESLVLTYIN
AISRGDLPCMENAVLALAQIENSAAVQKAIAHYDQQMGQKVQLPAETLQELLDLHRVSER
EATEVYMKNSFKDVDHLFQKKLAAQLDKKRDDFCKQNQEASSDRCSALLQVIFSPLEEEV
KAGIYSKPGGYCLFIQKLQDLEKKYYEEPRKGIQAEEILQTYLKSKESVTDAILQTDQIL
TEKEKEIEVECVKAESAQASAKMVEEMQIKYQQMMEEKEKSYQEHVKQLTEKMERERAQL
LEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0R5	1.000	1.000	6.630E-96	595	1.000	1.000	Q9H0R5.pdb.gz	GBP3_HUMAN Guanylate-binding protein 3 OS=Homo sapiens OX=9606 GN=GBP3 PE=1 SV=3
2	AFDB:P32455	0.944	0.949	9.592E-86	592	0.861	0.865	P32455.pdb.gz	GBP1_HUMAN Guanylate-binding protein 1 OS=Homo sapiens OX=9606 GN=GBP1 PE=1 SV=2
3	AFDB:P32456	0.940	0.946	2.097E-80	591	0.743	0.748	P32456.pdb.gz	GBP2_HUMAN Guanylate-binding protein 2 OS=Homo sapiens OX=9606 GN=GBP2 PE=1 SV=3
4	AFDB:B2XWS1	0.935	0.943	8.880E-80	590	0.751	0.758	B2XWS1.pdb.gz	B2XWS1_PIG Guanylate binding protein 1 OS=Sus scrofa OX=9823 GN=GBP1 PE=1 SV=1
5	AFDB:Q01514	0.928	0.938	1.422E-73	589	0.659	0.666	Q01514.pdb.gz	GBP1_MOUSE Guanylate-binding protein 1 OS=Mus musculus OX=10090 GN=Gbp1 PE=1 SV=1
6	AFDB:Q9Z0E6	0.923	0.933	6.566E-72	589	0.649	0.655	Q9Z0E6.pdb.gz	GBP2_MOUSE Guanylate-binding protein 2 OS=Mus musculus OX=10090 GN=Gbp2 PE=1 SV=1
7	PDB:6lojB	0.880	0.916	5.044E-69	571	0.842	0.877	6lojB.pdb.gz	Substrate-binding destabilizes the hydrophobic cluster to relieve the autoinhibition of bacterial ubiquitin ligase IpaH9.8.
8	PDB:6k1zA	0.855	0.933	2.740E-68	544	0.792	0.866	6k1zA.pdb.gz	Structural mechanism for guanylate-binding proteins (GBPs) targeting by the Shigella E3 ligase IpaH9.8.
9	PDB:7m1sA	0.884	0.910	1.489E-67	577	0.736	0.759	7m1sA.pdb.gz
10	AFDB:Q96PP9	0.917	0.853	1.236E-66	640	0.529	0.492	Q96PP9.pdb.gz	GBP4_HUMAN Guanylate-binding protein 4 OS=Homo sapiens OX=9606 GN=GBP4 PE=1 SV=2
11	AFDB:Q6ZN66	0.895	0.844	1.624E-64	633	0.509	0.479	Q6ZN66.pdb.gz	GBP6_HUMAN Guanylate-binding protein 6 OS=Homo sapiens OX=9606 GN=GBP6 PE=1 SV=1
12	AFDB:Q96PP8	0.775	0.786	2.672E-64	586	0.666	0.676	Q96PP8.pdb.gz	GBP5_HUMAN Guanylate-binding protein 5 OS=Homo sapiens OX=9606 GN=GBP5 PE=1 SV=1
13	AFDB:Q8N8V2	0.905	0.845	9.274E-64	638	0.538	0.502	Q8N8V2.pdb.gz	GBP7_HUMAN Guanylate-binding protein 7 OS=Homo sapiens OX=9606 GN=GBP7 PE=1 SV=2
14	PDB:3x1dA	0.424	0.620	9.301E-12	381	0.133	0.207	3x1dA.pdb.gz	Comparison of human and Drosophila atlastin GTPases
15	PDB:7pw4C	0.317	0.559	8.723E-7	310	0.079	0.152	7pw4C.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.
16	PDB:3zjcE	0.213	0.390	1.220E-5	286	0.079	0.164	3zjcE.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
17	PDB:3zjcF	0.206	0.406	2.330E-5	252	0.061	0.143	3zjcF.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
18	PDB:1nf3A	0.202	0.513	5.709E-5	194	0.054	0.165	1nf3A.pdb.gz	Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
19	PDB:1zbdA	0.164	0.435	9.391E-5	177	0.050	0.169	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
20	PDB:3doeA	0.196	0.523	9.391E-5	189	0.052	0.164	3doeA.pdb.gz	Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JDV3	579	611	0.486	0.473	GBP6_MOUSE Guanylate-binding protein 6 OS=Mus musculus OX=10090 GN=Gbp6 PE=2 SV=2
2	B2XWS1	915	590	0.746	0.753	B2XWS1_PIG Guanylate binding protein 1 OS=Sus scrofa OX=9823 GN=GBP1 PE=1 SV=1
3	L7N1X8	581	611	0.486	0.473	L7N1X8_MOUSE Predicted gene 43302 OS=Mus musculus OX=10090 GN=Gm43302 PE=3 SV=2
4	P32455	1067	592	0.864	0.868	GBP1_HUMAN Guanylate-binding protein 1 OS=Homo sapiens OX=9606 GN=GBP1 PE=1 SV=2
5	P32456	927	591	0.743	0.748	GBP2_HUMAN Guanylate-binding protein 2 OS=Homo sapiens OX=9606 GN=GBP2 PE=1 SV=3
6	Q000W5	570	611	0.477	0.465	Q000W5_MOUSE Guanylate-binding protein 10 OS=Mus musculus OX=10090 GN=Gbp10 PE=2 SV=1
7	Q01514	808	589	0.661	0.667	GBP1_MOUSE Guanylate-binding protein 1 OS=Mus musculus OX=10090 GN=Gbp1 PE=1 SV=1
8	Q29RG2	568	611	0.477	0.465	Q29RG2_MOUSE Guanylate-binding protein 10 OS=Mus musculus OX=10090 GN=Gbp10 PE=2 SV=1
9	Q2M1J9	565	611	0.476	0.463	Q2M1J9_MOUSE Guanylate-binding protein 10 OS=Mus musculus OX=10090 GN=Gbp10 PE=2 SV=1
10	Q61107	639	620	0.514	0.494	GBP3_MOUSE Guanylate-binding protein 3 OS=Mus musculus OX=10090 GN=Gbp3 PE=1 SV=1
11	Q6PG83	571	619	0.479	0.460	Q6PG83_MOUSE cDNA sequence BC057170 OS=Mus musculus OX=10090 GN=Gbp9 PE=2 SV=1
12	Q6ZN66	626	633	0.509	0.479	GBP6_HUMAN Guanylate-binding protein 6 OS=Homo sapiens OX=9606 GN=GBP6 PE=1 SV=1
13	Q8BTS3	570	619	0.477	0.459	Q8BTS3_MOUSE Guanylate-binding protein 9 OS=Mus musculus OX=10090 GN=Gbp9 PE=1 SV=1
14	Q8CFB4	701	590	0.576	0.581	GBP5_MOUSE Guanylate-binding protein 5 OS=Mus musculus OX=10090 GN=Gbp5 PE=1 SV=2
15	Q8N8V2	636	638	0.546	0.509	GBP7_HUMAN Guanylate-binding protein 7 OS=Homo sapiens OX=9606 GN=GBP7 PE=1 SV=2
16	Q91Z40	654	638	0.536	0.500	GBP7_MOUSE Guanylate-binding protein 7 OS=Mus musculus OX=10090 GN=Gbp7 PE=1 SV=2
17	Q96PP8	784	586	0.666	0.676	GBP5_HUMAN Guanylate-binding protein 5 OS=Homo sapiens OX=9606 GN=GBP5 PE=1 SV=1
18	Q96PP9	634	640	0.529	0.492	GBP4_HUMAN Guanylate-binding protein 4 OS=Homo sapiens OX=9606 GN=GBP4 PE=1 SV=2
19	Q9H0R5	1231	595	1.000	1.000	GBP3_HUMAN Guanylate-binding protein 3 OS=Homo sapiens OX=9606 GN=GBP3 PE=1 SV=3
20	Q9Z0E6	780	589	0.655	0.662	GBP2_MOUSE Guanylate-binding protein 2 OS=Mus musculus OX=10090 GN=Gbp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02263 GBP	3.2e-121	415.1	Guanylate-binding protein, N-terminal domain
2	PF02841 GBP_C	5.8e-118	405.2	Guanylate-binding protein, C-terminal domain
3	PF01926 MMR_HSR1	13	17.3	50S ribosome-binding GTPase
4	PF05879 RHD3_GTPase	0.36	21.7	Root hair defective 3 GTP-binding protein (RHD3) GTPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359512

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359504	0.790	Guanylate-binding protein 1
2	9606.ENSP00000359497	0.739	Guanylate-binding protein 2
3	9606.ENSP00000343658	0.608	Mitogen-activated protein kinase kinase kinase kinase 4
4	9606.ENSP00000245414	0.591	Interferon regulatory factor 1
5	9606.ENSP00000360869	0.573	Interferon-induced protein with tetratricopeptide repeats 1
6	9606.ENSP00000360883	0.571	Interferon-induced protein with tetratricopeptide repeats 3
7	9606.ENSP00000337383	0.563	NACHT, LRR and PYD domains-containing protein 3
8	9606.ENSP00000215794	0.549	Ubl carboxyl-terminal hydrolase 18
9	9606.ENSP00000359783	0.547	Interferon-induced protein 44
10	9606.ENSP00000380697	0.543	Interferon regulatory factor 7
11	9606.ENSP00000360891	0.513	Interferon-induced protein with tetratricopeptide repeats 2
12	9606.ENSP00000428220	0.509	Immunity-related GTPase family M protein
13	9606.ENSP00000354394	0.504	Signal transducer and activator of transcription 1-alpha/beta
14	9606.ENSP00000342278	0.503	2'-5'-oligoadenylate synthase 2
15	9606.ENSP00000257570	0.501	2'-5'-oligoadenylate synthase-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:1901363	0.974	heterocyclic compound binding
GO:0097159	0.974	organic cyclic compound binding
GO:0003824	0.945	catalytic activity
GO:0097367	0.936	carbohydrate derivative binding
GO:0043168	0.930	anion binding
GO:0017076	0.930	purine nucleotide binding
GO:0032555	0.920	purine ribonucleotide binding
GO:0035639	0.876	purine ribonucleoside triphosphate binding
GO:0019001	0.868	guanyl nucleotide binding
GO:0016787	0.850	hydrolase activity
GO:0017111	0.843	ribonucleoside triphosphate phosphatase activity
GO:0032561	0.843	guanyl ribonucleotide binding
GO:0003924	0.789	GTPase activity
GO:0005525	0.773	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051716	0.996	cellular response to stimulus
GO:0034097	0.995	response to cytokine
GO:0071345	0.994	cellular response to cytokine stimulus
GO:0006950	0.976	response to stress
GO:0051707	0.976	response to other organism
GO:0098542	0.972	defense response to other organism
GO:0002376	0.954	immune system process
GO:0045087	0.936	innate immune response
GO:0034612	0.785	response to tumor necrosis factor
GO:0071356	0.777	cellular response to tumor necrosis factor
GO:0070555	0.746	response to interleukin-1
GO:0050789	0.621	regulation of biological process
GO:0050794	0.613	regulation of cellular process
GO:0034341	0.455	response to type II interferon
GO:0071346	0.444	cellular response to type II interferon
GO:0048518	0.382	positive regulation of biological process
GO:0060255	0.380	regulation of macromolecule metabolic process
GO:0048583	0.363	regulation of response to stimulus
GO:0048519	0.342	negative regulation of biological process
GO:0010468	0.312	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.902	endomembrane system
GO:0005634	0.811	nucleus
GO:0031974	0.751	membrane-enclosed lumen
GO:0031982	0.713	vesicle
GO:0031981	0.701	nuclear lumen
GO:0005654	0.694	nucleoplasm
GO:0097708	0.613	intracellular vesicle
GO:0005576	0.593	extracellular region
GO:0031410	0.587	cytoplasmic vesicle
GO:0016020	0.408	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.850	Hydrolases.
RHEA:23680	0.843	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.843	nucleoside-triphosphate phosphatase.
RHEA:19669	0.789	GTP + H2O = GDP + H(+) + phosphate

[back to server]