StarFunc result for job id Q9H0R8

User Input

>input (117 residues)
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0VGK0	1.000	1.000	8.791E-26	117	1.000	1.000	Q0VGK0.pdb.gz	GBRL1_RAT Gamma-aminobutyric acid receptor-associated protein-like 1 OS=Rattus norvegicus OX=10116 GN=Gabarapl1 PE=1 SV=1
2	AFDB:F1QY33	0.996	0.767	2.641E-23	152	0.872	0.671	F1QY33.pdb.gz	F1QY33_DANRE GABA(A) receptor-associated protein b OS=Danio rerio OX=7955 GN=gabarapb PE=3 SV=2
3	PDB:5yipA	0.978	0.931	2.841E-23	123	1.000	0.951	5yipA.pdb.gz	Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins.
4	AFDB:Q9W2S2	0.987	0.955	5.479E-23	121	0.846	0.818	Q9W2S2.pdb.gz	Q9W2S2_DROME Autophagy-related 8a, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg8a PE=1 SV=1
5	AFDB:Q09490	0.987	0.939	1.584E-22	123	0.778	0.740	Q09490.pdb.gz	LGG1_CAEEL Protein lgg-1 OS=Caenorhabditis elegans OX=6239 GN=lgg-1 PE=1 SV=1
6	PDB:7lswC	0.987	0.798	7.835E-22	145	0.863	0.697	7lswC.pdb.gz
7	PDB:7bruA	0.980	0.832	1.737E-21	138	0.855	0.725	7bruA.pdb.gz
8	AFDB:Q6NZZ7	0.983	0.707	2.404E-21	163	0.855	0.613	Q6NZZ7.pdb.gz	Q6NZZ7_DANRE Gabarap protein (Fragment) OS=Danio rerio OX=7955 GN=gabarap PE=2 SV=1
9	PDB:5azfA	0.957	0.941	2.636E-20	119	0.778	0.765	5azfA.pdb.gz	Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy.
10	PDB:7aa8C	0.939	0.827	3.010E-20	133	0.829	0.729	7aa8C.pdb.gz
11	AFDB:Q7K1J3	0.969	0.720	1.469E-19	158	0.735	0.544	Q7K1J3.pdb.gz	Q7K1J3_DROME AT01047p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Atg8b PE=2 SV=1
12	AFDB:Q8S926	0.971	0.932	9.415E-19	122	0.573	0.549	Q8S926.pdb.gz	ATG8E_ARATH Autophagy-related protein 8e OS=Arabidopsis thaliana OX=3702 GN=ATG8E PE=1 SV=2
13	AFDB:P60519	0.987	0.987	1.075E-18	117	0.607	0.607	P60519.pdb.gz	GBRL2_BOVIN Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Bos taurus OX=9913 GN=GABARAPL2 PE=1 SV=1
14	AFDB:Q8VYK7	0.971	0.939	2.721E-18	121	0.538	0.521	Q8VYK7.pdb.gz	ATG8F_ARATH Autophagy-related protein 8f OS=Arabidopsis thaliana OX=3702 GN=ATG8F PE=1 SV=1
15	AFDB:Q9LZZ9	0.949	0.918	3.108E-18	121	0.564	0.545	Q9LZZ9.pdb.gz	ATG8G_ARATH Autophagy-related protein 8g OS=Arabidopsis thaliana OX=3702 GN=ATG8G PE=2 SV=1
16	PDB:6aagC	0.939	0.793	2.044E-16	139	0.556	0.468	6aagC.pdb.gz
17	PDB:7brnA	0.916	0.808	2.334E-16	133	0.547	0.481	7brnA.pdb.gz	Super-assembly of ER-phagy receptor Atg40 induces local ER remodeling at contacts with forming autophagosomal membranes.
18	PDB:7yo8A	0.918	0.770	3.968E-16	140	0.607	0.507	7yo8A.pdb.gz
19	PDB:6aafA	0.936	0.977	5.529E-16	112	0.530	0.554	6aafA.pdb.gz	Lipidation-independent vacuolar functions of Atg8 rely on its noncanonical interaction with a vacuole membrane protein
20	PDB:5l83B	0.899	0.937	8.796E-16	112	0.530	0.554	5l83B.pdb.gz	Structural Basis of Host Autophagy-related Protein 8 (ATG8) Binding by the Irish Potato Famine Pathogen Effector Protein PexRD54.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0VGK0	1.57e-82	238	117	1.000	1.000	GBRL1_RAT Gamma-aminobutyric acid receptor-associated protein-like 1 OS=Rattus norvegicus OX=10116 GN=Gabarapl1 PE=1 SV=1
2	Q8R3R8	1.57e-82	238	117	1.000	1.000	GBRL1_MOUSE Gamma-aminobutyric acid receptor-associated protein-like 1 OS=Mus musculus OX=10090 GN=Gabarapl1 PE=1 SV=2
3	Q9H0R8	1.57e-82	238	117	1.000	1.000	GBRL1_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 1 OS=Homo sapiens OX=9606 GN=GABARAPL1 PE=1 SV=1
4	F1QY33	6.39e-74	218	152	0.872	0.671	F1QY33_DANRE GABA(A) receptor-associated protein b OS=Danio rerio OX=7955 GN=gabarapb PE=3 SV=2
5	O95166	4.14e-72	212	117	0.863	0.863	GBRAP_HUMAN Gamma-aminobutyric acid receptor-associated protein OS=Homo sapiens OX=9606 GN=GABARAP PE=1 SV=1
6	P60517	4.14e-72	212	117	0.863	0.863	GBRAP_RAT Gamma-aminobutyric acid receptor-associated protein OS=Rattus norvegicus OX=10116 GN=Gabarap PE=1 SV=1
7	Q6IAW1	4.14e-72	212	117	0.863	0.863	Q6IAW1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=GABARAP PE=1 SV=1
8	Q9DCD6	4.14e-72	212	117	0.863	0.863	GBRAP_MOUSE Gamma-aminobutyric acid receptor-associated protein OS=Mus musculus OX=10090 GN=Gabarap PE=1 SV=2
9	Q9W2S2	1.90e-71	210	121	0.846	0.818	Q9W2S2_DROME Autophagy-related 8a, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg8a PE=1 SV=1
10	Q6PSS4	4.38e-71	209	122	0.855	0.820	Q6PSS4_DANRE GABA(A) receptor-associated protein OS=Danio rerio OX=7955 GN=gabarap PE=3 SV=1
11	Q6NZZ7	4.65e-71	211	163	0.855	0.613	Q6NZZ7_DANRE Gabarap protein (Fragment) OS=Danio rerio OX=7955 GN=gabarap PE=2 SV=1
12	Q09490	1.00e-64	194	123	0.778	0.740	LGG1_CAEEL Protein lgg-1 OS=Caenorhabditis elegans OX=6239 GN=lgg-1 PE=1 SV=1
13	Q9VEG5	1.77e-62	188	120	0.735	0.717	Q9VEG5_DROME Autophagy-related 8b, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg8b PE=1 SV=1
14	Q7K1J3	4.51e-62	188	158	0.735	0.544	Q7K1J3_DROME AT01047p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Atg8b PE=2 SV=1
15	X2JEE0	2.53e-54	167	107	0.667	0.729	X2JEE0_DROME Autophagy-related 8a, isoform C OS=Drosophila melanogaster OX=7227 GN=Atg8a PE=1 SV=1
16	X2JJA8	4.34e-53	163	96	0.650	0.792	X2JJA8_DROME Autophagy-related 8a, isoform B OS=Drosophila melanogaster OX=7227 GN=Atg8a PE=1 SV=1
17	P60519	2.43e-48	152	117	0.607	0.607	GBRL2_BOVIN Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Bos taurus OX=9913 GN=GABARAPL2 PE=1 SV=1
18	P60520	2.43e-48	152	117	0.607	0.607	GBRL2_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Homo sapiens OX=9606 GN=GABARAPL2 PE=1 SV=1
19	P60521	2.43e-48	152	117	0.607	0.607	GBRL2_MOUSE Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Mus musculus OX=10090 GN=Gabarapl2 PE=1 SV=1
20	Q9LZZ9	1.67e-46	147	121	0.564	0.545	ATG8G_ARATH Autophagy-related protein 8g OS=Arabidopsis thaliana OX=3702 GN=ATG8G PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04110 APG12	0.00013	33.6	Ubiquitin-like autophagy protein Apg12
2	PF02991 ATG8	8.7e-46	165.7	Autophagy protein Atg8 ubiquitin like
3	PF20111 DUF6501	18	16.6	Family of unknown function (DUF6501)
4	PF09164 VitD-bind_III	6.2e+02	11.8	Vitamin D binding protein, domain III

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 13616.ENSMODP00000036305

Rank	PPI partner	STRING score	Description
1	13616.ENSMODP00000022578	0.931	Autophagy-related protein 3
2	13616.ENSMODP00000007606	0.930	E1-like activating enzyme involved in the 2 ubiquitin-like systems required for cytoplasm to vacuole transport (Cvt) and autophagy. Activates ATG12 for its conjugation with ATG5 as well as the ATG8 family proteins for their conjugation with phosphatidylethanolamine. Both systems are needed for the ATG8 association to Cvt vesicles and autophagosomes membranes. Required for autophagic death induced by caspase-8 inhibition. Required for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy req [...]
3	13616.ENSMODP00000018942	0.921	NBR1, autophagy cargo receptor
4	13616.ENSMODP00000010772	0.911	Cysteine protease
5	13616.ENSMODP00000017069	0.881	Ubiquitin-like protein ATG12
6	13616.ENSMODP00000014520	0.876	Cysteine protease
7	13616.ENSMODP00000022479	0.859	Autophagy protein 5
8	13616.ENSMODP00000031921	0.825	Unc-51 like autophagy activating kinase 1
9	13616.ENSMODP00000001680	0.823	Cysteine protease
10	13616.ENSMODP00000007166	0.822	Cysteine protease
11	13616.ENSMODP00000013062	0.808	Autophagy related 16-like 1 (S. cerevisiae)
12	13616.ENSMODP00000025994	0.787	WD repeat and FYVE domain containing 3
13	13616.ENSMODP00000018835	0.781	Uncharacterized protein
14	13616.ENSMODP00000009557	0.772	Gamma-aminobutyric acid (GABA) A receptor, gamma 2
15	13616.ENSMODP00000004662	0.766	Uncharacterized protein
16	13616.ENSMODP00000040048	0.766	Uncharacterized protein
17	13616.ENSMODP00000013688	0.754	Unc-51 like autophagy activating kinase 2
18	13616.ENSMODP00000000262	0.753	Phosphatidylinositol 3-kinase, catalytic subunit type 3
19	13616.ENSMODP00000024092	0.731	Starch binding domain 1
20	13616.ENSMODP00000015056	0.722	Phosphoinositide-3-kinase, regulatory subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.689	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0061919	0.972	process utilizing autophagic mechanism
GO:0008152	0.968	metabolic process
GO:0044237	0.952	cellular metabolic process
GO:0044248	0.896	cellular catabolic process
GO:0006914	0.864	autophagy
GO:0065007	0.862	biological regulation
GO:0050789	0.841	regulation of biological process
GO:0050794	0.676	regulation of cellular process
GO:0071840	0.612	cellular component organization or biogenesis
GO:0016043	0.568	cellular component organization
GO:0006996	0.489	organelle organization
GO:0051179	0.461	localization
GO:0019222	0.450	regulation of metabolic process
GO:0071704	0.429	organic substance metabolic process
GO:0044238	0.424	primary metabolic process
GO:0051234	0.420	establishment of localization
GO:0016236	0.420	macroautophagy
GO:0006810	0.413	transport
GO:0032501	0.387	multicellular organismal process
GO:0048856	0.387	anatomical structure development
GO:0031323	0.384	regulation of cellular metabolic process
GO:0009894	0.376	regulation of catabolic process
GO:0050896	0.357	response to stimulus
GO:0043170	0.326	macromolecule metabolic process
GO:0051641	0.325	cellular localization
GO:0060255	0.305	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005773	0.996	vacuole
GO:0005829	0.968	cytosol
GO:0005776	0.967	autophagosome
GO:0016020	0.961	membrane
GO:0031090	0.900	organelle membrane
GO:0071944	0.893	cell periphery
GO:0005886	0.879	plasma membrane
GO:0098588	0.747	bounding membrane of organelle
GO:0012505	0.700	endomembrane system
GO:0042995	0.627	cell projection
GO:0005764	0.452	lysosome
GO:0005739	0.396	mitochondrion
GO:0044297	0.385	cell body
GO:0005774	0.372	vacuolar membrane
GO:0120025	0.337	plasma membrane bounded cell projection
GO:0070013	0.330	intracellular organelle lumen
GO:0043005	0.307	neuron projection
GO:0000421	0.306	autophagosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]