StarFunc result for job id Q9H0V1

User Input

>input (697 residues)
MCKSLRYCFSHCLYLAMTRLEEVNREVNMHSSVRYLGYLARINLLVAICLGLYVRWEKTA
NSLILVIFILGLFVLGIASILYYYFSMEAASLSLSNLWFGFLLGLLCFLDNSSFKNDVKE
ESTKYLLLTSIVLRILCSLVERISGYVRHRPTLLTTVEFLELVGFAIASTTMLVEKSLSV
ILLVVALAMLIIDLRMKSFLAIPNLVIFAVLLFFSSLETPKNPIAFACFFICLITDPFLD
IYFSGLSVTERWKPFLYRGRICRRLSVVFAGMIELTFFILSAFKLRDTHLWYFVIPGFSI
FGIFWMICHIIFLLTLWGFHTKLNDCHKVYFTHRTDYNSLDRIMASKGMRHFCLISEQLV
FFSLLATAILGAVSWQPTNGIFLSMFLIVLPLESMAHGLFHELGNCLGGTSVGYAIVIPT
NFCSPDGQPTLLPPEHVQELNLRSTGMLNAIQRFFAYHMIETYGCDYSTSGLSFDTLHSK
LKAFLELRTVDGPRHDTYILYYSGHTHGTGEWALAGGDTLRLDTLIEWWREKNGSFCSRL
IIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSS
NNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAKHWMLHFPRITYPLVHLANWLCGL
NLFWICKTCFRCLKRLKMSWFLPTVLDTGQGFKLVKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91VX9	0.998	0.998	5.977E-96	697	0.954	0.954	Q91VX9.pdb.gz	TM168_MOUSE Transmembrane protein 168 OS=Mus musculus OX=10090 GN=Tmem168 PE=1 SV=1
2	PDB:4nblA	0.173	0.397	7.349E-3	258	0.040	0.109	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
3	AFDB:Q9GPM2	0.190	0.302	7.380E-3	406	0.044	0.076	Q9GPM2.pdb.gz	PCP_DICDI Paracaspase OS=Dictyostelium discoideum OX=44689 GN=pcp PE=2 SV=1
4	AFDB:G5EBM1	0.185	0.233	1.719E-2	536	0.034	0.045	G5EBM1.pdb.gz	CSP1_CAEEL Caspase A OS=Caenorhabditis elegans OX=6239 GN=csp-1 PE=1 SV=1
5	PDB:4pryA	0.146	0.353	2.027E-2	249	0.023	0.064	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
6	PDB:4fdlB	0.172	0.439	2.612E-2	239	0.033	0.096	4fdlB.pdb.gz
7	AFDB:O02002	0.174	0.333	4.357E-2	323	0.033	0.071	O02002.pdb.gz	CASP1_DROME Caspase-1 OS=Drosophila melanogaster OX=7227 GN=Dcp-1 PE=1 SV=1
8	AFDB:Q8T4E1	0.199	0.355	5.858E-2	355	0.049	0.096	Q8T4E1.pdb.gz	GPI8_DROME Putative GPI-anchor transamidase OS=Drosophila melanogaster OX=7227 GN=PIG-K PE=2 SV=1
9	AFDB:Q7KHK9	0.172	0.219	6.650E-2	527	0.034	0.046	Q7KHK9.pdb.gz	Q7KHK9_DROME DREAM OS=Drosophila melanogaster OX=7227 GN=Strica PE=1 SV=1
10	PDB:4fguA	0.188	0.302	7.518E-2	407	0.046	0.079	4fguA.pdb.gz
11	PDB:6j79A	0.118	0.104	9.287E-2	816	0.055	0.047	6j79A.pdb.gz	Crystal structure of a NADPH-cytochrome P450 oxidoreductase (CYPOR) and heme oxygenase 1 fusion protein implies a conformational change in CYPOR upon NADPH/NADP+binding.
12	PDB:1yvpB	0.106	0.134	1.197E-1	532	0.077	0.102	1yvpB.pdb.gz	Structural Insights into RNA Quality Control: The Ro Autoantigen Binds Misfolded RNAs via Its Central Cavity
13	PDB:4af8A	0.208	0.387	1.417E-1	333	0.036	0.075	4af8A.pdb.gz
14	PDB:6u62A	0.189	0.125	1.827E-1	1110	0.050	0.032	6u62A.pdb.gz	Structural basis for the docking of mTORC1 on the lysosomal surface.
15	PDB:7wzsB	0.170	0.476	2.354E-1	206	0.029	0.097	7wzsB.pdb.gz
16	PDB:6orbA	0.096	0.028	3.444E-1	3352	0.086	0.018	6orbA.pdb.gz
17	AFDB:Q68KI4	0.095	0.113	3.459E-1	538	0.102	0.132	Q68KI4.pdb.gz	NHX1_ARATH Sodium/hydrogen exchanger 1 OS=Arabidopsis thaliana OX=3702 GN=NHX1 PE=1 SV=2
18	AFDB:O74923	0.097	0.119	3.608E-1	522	0.062	0.082	O74923.pdb.gz	YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC757.13 PE=3 SV=1
19	AFDB:P34711	0.101	0.120	3.608E-1	532	0.069	0.090	P34711.pdb.gz	UNC17_CAEEL Vesicular acetylcholine transporter unc-17 OS=Caenorhabditis elegans OX=6239 GN=unc-17 PE=1 SV=1
20	AFDB:P9WNQ7	0.152	0.190	4.096E-1	511	0.076	0.104	P9WNQ7.pdb.gz	ECCD1_MYCTU ESX-1 secretion system protein EccD1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=eccD1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q91VX9	0.0	1354	697	0.954	0.954	TM168_MOUSE Transmembrane protein 168 OS=Mus musculus OX=10090 GN=Tmem168 PE=1 SV=1
2	Q9H0V1	0.0	1429	697	1.000	1.000	TM168_HUMAN Transmembrane protein 168 OS=Homo sapiens OX=9606 GN=TMEM168 PE=1 SV=2
3	B9WZX4	0.074	38.5	526	0.030	0.040	FTME_ASPFM Fumitremorgin C synthase OS=Aspergillus fumigatus OX=746128 GN=ftmP450-2 PE=1 SV=1
4	Q4WAW8	0.074	38.5	526	0.030	0.040	FTME_ASPFU Fumitremorgin C synthase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=ftmP450-2 PE=1 SV=1
5	O42924	2.2	33.5	272	0.024	0.062	EAF7_SCHPO Probable chromatin modification-related protein eaf7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eaf7 PE=1 SV=1
6	Q7TNJ5	2.5	33.9	944	0.030	0.022	Q7TNJ5_MOUSE Mcf2 proto-oncogene protein OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
7	Q99N72	2.5	33.9	928	0.030	0.023	Q99N72_MOUSE Mcf2 proto-oncogene protein OS=Mus musculus OX=10090 GN=Mcf2 PE=1 SV=1
8	Q8BLE2	3.4	33.5	1031	0.030	0.020	Q8BLE2_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
9	A2AET8	4.0	33.1	944	0.030	0.022	A2AET8_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=4 SV=1
10	Q8C067	4.0	33.1	928	0.030	0.023	Q8C067_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
11	P22760	5.9	32.3	399	0.044	0.078	AAAD_HUMAN Arylacetamide deacetylase OS=Homo sapiens OX=9606 GN=AADAC PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02238 COX7a	9.2e+02	11.7	Cytochrome c oxidase subunit VII
2	PF04906 Tweety	24	15.1	Tweety

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323068

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297145	0.777	Probable methyltransferase BMT2 homolog
2	9606.ENSP00000332511	0.721	Olfactomedin-like protein 1
3	9606.ENSP00000242819	0.582	Coiled-coil domain containing 70
4	9606.ENSP00000297146	0.581	Probable G-protein coupled receptor 85
5	9606.ENSP00000331662	0.556	Armadillo repeat-containing X-linked protein 2
6	9606.ENSP00000378517	0.554	Osteopontin
7	9606.ENSP00000259746	0.543	CSC1-like protein 2
8	9606.ENSP00000238609	0.534	Interferon alpha inducible protein 27 like 2
9	9606.ENSP00000260283	0.533	Rho GTPase-activating protein 20
10	9606.ENSP00000284601	0.533	Protein phosphatase 1 regulatory subunit 3A
11	9606.ENSP00000262198	0.526	Activity-dependent neuroprotector homeobox protein 2
12	9606.ENSP00000346300	0.519	Crk-like protein
13	9606.ENSP00000265440	0.508	Transcription factor EC
14	9606.ENSP00000413064	0.502	N-acetylaspartate synthetase
15	9606.ENSP00000384477	0.500	Interferon-related developmental regulator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017080	1.000	sodium channel regulator activity
GO:0005488	0.991	binding
GO:0005515	0.982	protein binding
GO:0003824	0.522	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0080090	0.956	regulation of primary metabolic process
GO:0051171	0.930	regulation of nitrogen compound metabolic process
GO:0031323	0.921	regulation of cellular metabolic process
GO:0060255	0.905	regulation of macromolecule metabolic process
GO:0032409	0.830	regulation of transporter activity
GO:0034762	0.810	regulation of transmembrane transport
GO:0051246	0.803	regulation of protein metabolic process
GO:0043269	0.793	regulation of monoatomic ion transport
GO:0009894	0.768	regulation of catabolic process
GO:0002028	0.704	regulation of sodium ion transport
GO:1902305	0.694	regulation of sodium ion transmembrane transport
GO:0032412	0.684	regulation of monoatomic ion transmembrane transporter activity
GO:2000649	0.657	regulation of sodium ion transmembrane transporter activity
GO:0009987	0.654	cellular process
GO:0030162	0.617	regulation of proteolysis
GO:1903050	0.613	regulation of proteolysis involved in protein catabolic process
GO:2001257	0.542	regulation of cation channel activity
GO:0031329	0.494	regulation of cellular catabolic process
GO:2000058	0.429	regulation of ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	0.999	organelle membrane
GO:0005635	0.998	nuclear envelope
GO:0005737	0.989	cytoplasm
GO:0031965	0.985	nuclear membrane
GO:0031982	0.472	vesicle
GO:0005886	0.371	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]