StarFunc result for job id Q9H0W8

User Input

>input (520 residues)
MSESGHSQPGLYGIERRRRWKEPGSGGPQNLSGPGGRERDYIAPWERERRDASEETSTSV
MQKTPIILSKPPAERSKQPPPPTAPAAPPAPAPLEKPIVLMKPREEGKGPVAVTGASTPE
GTAPPPPAAPAPPKGEKEGQRPTQPVYQIQNRGMGTAAPAAMDPVVGQAKLLPPERMKHS
IKLVDDQMNWCDSAIEYLLDQTDVLVVGVLGLQGTGKSMVMSLLSANTPEEDQRTYVFRA
QSAEMKERGGNQTSGIDFFITQERIVFLDTQPILSPSILDHLINNDRKLPPEYNLPHTYV
EMQSLQIAAFLFTVCHVVIVVQDWFTDLSLYRFLQTAEMVKPSTPSPSHESSSSSGSDEG
TEYYPHLVFLQNKARREDFCPRKLRQMHLMIDQLMAHSHLRYKGTLSMLQCNVFPGLPPD
FLDSEVNLFLVPFMDSEAESENPPRAGPGSSPLFSLLPGYRGHPSFQSLVSKLRSQVMSM
ARPQLSHTILTEKNWFHYAARIWDGVRKSSALAEYSRLLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9DB90	0.666	0.666	5.936E-83	520	0.973	0.973	Q9DB90.pdb.gz	SMG9_MOUSE Nonsense-mediated mRNA decay factor SMG9 OS=Mus musculus OX=10090 GN=Smg9 PE=1 SV=1
2	PDB:7pw4C	0.573	0.955	1.866E-49	310	0.592	0.994	7pw4C.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.
3	AFDB:Q9XWJ1	0.488	0.651	3.339E-23	385	0.173	0.234	Q9XWJ1.pdb.gz	SMG9_CAEEL Nonsense-mediated mRNA decay factor SMG9 OS=Caenorhabditis elegans OX=6239 GN=smg-9 PE=1 SV=1
4	PDB:6lojB	0.362	0.333	4.963E-6	571	0.098	0.089	6lojB.pdb.gz	Substrate-binding destabilizes the hydrophobic cluster to relieve the autoinhibition of bacterial ubiquitin ligase IpaH9.8.
5	PDB:7pw5B	0.312	0.240	6.636E-6	702	0.094	0.070	7pw5B.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.
6	AFDB:Q8IYD1	0.227	0.192	1.725E-5	628	0.108	0.089	Q8IYD1.pdb.gz	ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens OX=9606 GN=GSPT2 PE=1 SV=2
7	AFDB:Q9SLF3	0.252	0.120	2.746E-5	1206	0.142	0.061	Q9SLF3.pdb.gz	TC132_ARATH Translocase of chloroplast 132, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC132 PE=1 SV=1
8	PDB:7m1sA	0.301	0.275	3.185E-5	577	0.085	0.076	7m1sA.pdb.gz
9	PDB:6j6gC	0.203	0.125	4.259E-5	920	0.073	0.041	6j6gC.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
10	PDB:6k1zA	0.298	0.286	4.514E-5	544	0.090	0.086	6k1zA.pdb.gz	Structural mechanism for guanylate-binding proteins (GBPs) targeting by the Shigella E3 ligase IpaH9.8.
11	AFDB:P91944	0.185	0.160	6.193E-5	619	0.140	0.118	P91944.pdb.gz	P91944_DROME Elongation factor 1 alpha-like factor OS=Drosophila melanogaster OX=7227 GN=eRF3 PE=2 SV=1
12	PDB:3jb9B	0.232	0.146	7.615E-5	904	0.073	0.042	3jb9B.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
13	PDB:3zjcF	0.228	0.410	1.079E-4	252	0.060	0.123	3zjcF.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
14	AFDB:Q9LUS2	0.239	0.127	1.868E-4	1089	0.148	0.071	Q9LUS2.pdb.gz	TC120_ARATH Translocase of chloroplast 120, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC120 PE=1 SV=1
15	PDB:7po27	0.191	0.176	2.167E-4	571	0.063	0.058	7po27.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
16	PDB:7qp6t	0.206	0.287	2.167E-4	356	0.052	0.076	7qp6t.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
17	AFDB:Q8CB87	0.184	0.105	5.315E-4	973	0.127	0.068	Q8CB87.pdb.gz	RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus OX=10090 GN=Rab44 PE=1 SV=2
18	AFDB:Q7Z6P3	0.193	0.107	3.411E-3	1021	0.119	0.061	Q7Z6P3.pdb.gz	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
19	AFDB:Q8I3U2	0.218	0.080	4.304E-3	1610	0.069	0.022	Q8I3U2.pdb.gz	Q8I3U2_PLAF7 Sporozoite surface antigen MB2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0516600 PE=3 SV=1
20	AFDB:F8VVT9	0.147	0.073	5.430E-3	1192	0.121	0.053	F8VVT9.pdb.gz	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9DB90	0.0	1045	520	0.973	0.973	SMG9_MOUSE Nonsense-mediated mRNA decay factor SMG9 OS=Mus musculus OX=10090 GN=Smg9 PE=1 SV=1
2	Q9H0W8	0.0	1070	520	1.000	1.000	SMG9_HUMAN Nonsense-mediated mRNA decay factor SMG9 OS=Homo sapiens OX=9606 GN=SMG9 PE=1 SV=1
3	Q9XWJ1	2.35e-17	86.3	385	0.131	0.177	SMG9_CAEEL Nonsense-mediated mRNA decay factor SMG9 OS=Caenorhabditis elegans OX=6239 GN=smg-9 PE=1 SV=1
4	O46080	1.61e-13	75.1	487	0.200	0.214	SMG9_DROME Protein SMG9 OS=Drosophila melanogaster OX=7227 GN=CG3857 PE=2 SV=1
5	M9PC48	0.24	37.0	18095	0.075	0.002	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
6	M9PCJ6	0.24	37.0	18641	0.075	0.002	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
7	Q9D6N5	0.83	33.9	205	0.050	0.127	NC2A_MOUSE Dr1-associated corepressor OS=Mus musculus OX=10090 GN=Drap1 PE=1 SV=3
8	Q14919	1.0	33.9	205	0.054	0.137	NC2A_HUMAN Dr1-associated corepressor OS=Homo sapiens OX=9606 GN=DRAP1 PE=1 SV=3
9	Q57ZC8	4.0	32.7	475	0.037	0.040	Q57ZC8_TRYB2 RecQ mediated genome instability protein 1 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.520 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13604 AAA_30	3.3e+02	12.4	AAA domain
2	PF19557 DUF6079	9.7e+02	8.5	Family of unknown function (DUF6079)
3	PF10220 Smg8_Smg9	0.078	23.0	Smg8_Smg9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000270066

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000402515	0.999	Serine/threonine-protein kinase SMG1
2	9606.ENSP00000438748	0.999	Protein SMG8
3	9606.ENSP00000348708	0.928	Regulator of nonsense transcripts 2
4	9606.ENSP00000470142	0.925	Regulator of nonsense transcripts 1
5	9606.ENSP00000263073	0.915	Telomerase-binding protein EST1A
6	9606.ENSP00000425133	0.906	Protein SMG7
7	9606.ENSP00000355261	0.893	Protein SMG5
8	9606.ENSP00000464167	0.883	Uncharacterized protein
9	9606.ENSP00000364448	0.881	Regulator of nonsense transcripts 3A
10	9606.ENSP00000331907	0.862	Probable ATP-dependent RNA helicase DHX34
11	9606.ENSP00000276201	0.836	Regulator of nonsense transcripts 3B
12	9606.ENSP00000398131	0.829	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
13	9606.ENSP00000353741	0.819	Eukaryotic peptide chain release factor subunit 1
14	9606.ENSP00000364289	0.773	Nuclear cap-binding protein subunit 1
15	9606.ENSP00000264951	0.758	5'-3' exoribonuclease 1
16	9606.ENSP00000264645	0.756	Protein CASC3
17	9606.ENSP00000463058	0.746	RNA-binding protein 8A
18	9606.ENSP00000281513	0.743	Neuroblastoma-amplified sequence
19	9606.ENSP00000334840	0.704	Proline-rich nuclear receptor coactivator 2
20	9606.ENSP00000296490	0.656	WD repeat-containing protein 82

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003824	0.302	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0000956	0.986	nuclear-transcribed mRNA catabolic process
GO:0000184	0.984	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0050794	0.811	regulation of cellular process
GO:0032502	0.638	developmental process
GO:0032501	0.637	multicellular organismal process
GO:0031323	0.625	regulation of cellular metabolic process
GO:0048856	0.619	anatomical structure development
GO:0007275	0.590	multicellular organism development
GO:0048731	0.522	system development
GO:0051171	0.514	regulation of nitrogen compound metabolic process
GO:0060322	0.505	head development
GO:0043009	0.415	chordate embryonic development
GO:0048880	0.412	sensory system development
GO:0048513	0.406	animal organ development
GO:0080090	0.363	regulation of primary metabolic process
GO:0001654	0.309	eye development
GO:0007399	0.306	nervous system development
GO:0072359	0.302	circulatory system development
GO:0007417	0.300	central nervous system development
GO:0001701	0.300	in utero embryonic development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0032991	0.963	protein-containing complex
GO:0005634	0.895	nucleus
GO:0043233	0.652	organelle lumen
GO:0070013	0.637	intracellular organelle lumen
GO:0031981	0.623	nuclear lumen
GO:0005654	0.526	nucleoplasm
GO:0016020	0.489	membrane
GO:0043232	0.484	intracellular non-membrane-bounded organelle
GO:0012505	0.338	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]