StarFunc result for job id Q9H0Y0

User Input

>input (220 residues)
MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLG
ASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDG
RPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQ
KINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0Y0	1.000	1.000	7.495E-43	220	1.000	1.000	Q9H0Y0.pdb.gz	ATG10_HUMAN Ubiquitin-like-conjugating enzyme ATG10 OS=Homo sapiens OX=9606 GN=ATG10 PE=1 SV=1
2	AFDB:Q8R1P4	0.893	0.913	5.335E-33	215	0.786	0.805	Q8R1P4.pdb.gz	ATG10_MOUSE Ubiquitin-like-conjugating enzyme ATG10 OS=Mus musculus OX=10090 GN=Atg10 PE=1 SV=1
3	AFDB:Q8VZ52	0.702	0.689	9.400E-15	225	0.309	0.302	Q8VZ52.pdb.gz	ATG10_ARATH Ubiquitin-like-conjugating enzyme ATG10 OS=Arabidopsis thaliana OX=3702 GN=ATG10 PE=1 SV=1
4	AFDB:Q18991	0.538	0.722	1.163E-9	157	0.191	0.268	Q18991.pdb.gz	Q18991_CAEEL Autophagy_act_C domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=atg-10 PE=4 SV=2
5	AFDB:O43035	0.553	0.451	2.815E-9	275	0.200	0.160	O43035.pdb.gz	ATG3_SCHPO Autophagy-related protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg3 PE=3 SV=1
6	AFDB:Q9UTD5	0.580	0.695	5.383E-9	179	0.159	0.196	Q9UTD5.pdb.gz	ATG10_SCHPO Ubiquitin-like-conjugating enzyme ATG10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ATG10 PE=3 SV=1
7	AFDB:Q9N369	0.550	0.408	1.855E-8	305	0.218	0.157	Q9N369.pdb.gz	Q9N369_CAEEL Ubiquitin-like-conjugating enzyme ATG3 OS=Caenorhabditis elegans OX=6239 GN=atg-3 PE=1 SV=1
8	AFDB:C0H519	0.568	0.412	1.153E-7	313	0.177	0.125	C0H519.pdb.gz	C0H519_PLAF7 Autophagy-related protein 3, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905700.2 PE=1 SV=1
9	AFDB:Q9VVS6	0.586	0.404	3.139E-7	330	0.191	0.127	Q9VVS6.pdb.gz	Q9VVS6_DROME Ubiquitin-like-conjugating enzyme ATG3 OS=Drosophila melanogaster OX=7227 GN=Atg3 PE=1 SV=1
10	AFDB:Q6AZ50	0.588	0.424	1.020E-6	314	0.191	0.134	Q6AZ50.pdb.gz	ATG3_RAT Ubiquitin-like-conjugating enzyme ATG3 OS=Rattus norvegicus OX=10116 GN=Atg3 PE=2 SV=1
11	PDB:3vx8B	0.573	0.705	1.423E-5	175	0.127	0.160	3vx8B.pdb.gz
12	PDB:2dytA	0.428	0.440	1.509E-5	213	0.150	0.155	2dytA.pdb.gz	The crystal structure of Atg3, an autophagy-related ubiquitin carrier protein (E2) enzyme that mediates Atg8 lipidation
13	PDB:4gslC	0.490	0.567	9.948E-5	186	0.150	0.177	4gslC.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
14	PDB:4ebrA	0.366	0.485	3.048E-4	157	0.155	0.217	4ebrA.pdb.gz
15	PDB:1tlbA	0.165	0.129	3.203E-2	326	0.136	0.092	1tlbA.pdb.gz
16	PDB:4gskY	0.322	0.473	6.125E-2	137	0.136	0.219	4gskY.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
17	PDB:7q2xB	0.068	0.048	3.382E-1	388	0.023	0.013	7q2xB.pdb.gz	Clamping of DNA shuts the condensin neck gate.
18	PDB:7db7B	0.149	0.052	4.036E-1	836	0.105	0.028	7db7B.pdb.gz	Re-discovery of PF-3845 as a new chemical scaffold inhibiting phenylalanyl-tRNA synthetase in Mycobacterium tuberculosis .
19	PDB:3kxyA	0.136	0.198	6.860E-1	133	0.059	0.098	3kxyA.pdb.gz
20	PDB:8d0kF	0.110	0.035	7.276E-1	915	0.036	0.009	8d0kF.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H0Y0	8.00e-169	465	220	1.000	1.000	ATG10_HUMAN Ubiquitin-like-conjugating enzyme ATG10 OS=Homo sapiens OX=9606 GN=ATG10 PE=1 SV=1
2	Q8R1P4	6.51e-132	371	215	0.786	0.805	ATG10_MOUSE Ubiquitin-like-conjugating enzyme ATG10 OS=Mus musculus OX=10090 GN=Atg10 PE=1 SV=1
3	Q8VZ52	1.26e-24	99.0	225	0.259	0.253	ATG10_ARATH Ubiquitin-like-conjugating enzyme ATG10 OS=Arabidopsis thaliana OX=3702 GN=ATG10 PE=1 SV=1
4	Q18991	2.94e-14	69.7	157	0.164	0.229	Q18991_CAEEL Autophagy_act_C domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=atg-10 PE=4 SV=2
5	Q9N369	2.43e-04	43.5	305	0.141	0.102	Q9N369_CAEEL Ubiquitin-like-conjugating enzyme ATG3 OS=Caenorhabditis elegans OX=6239 GN=atg-3 PE=1 SV=1
6	Q9VVS6	0.001	41.2	330	0.118	0.079	Q9VVS6_DROME Ubiquitin-like-conjugating enzyme ATG3 OS=Drosophila melanogaster OX=7227 GN=Atg3 PE=1 SV=1
7	C0H519	0.004	39.7	313	0.145	0.102	C0H519_PLAF7 Autophagy-related protein 3, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905700.2 PE=1 SV=1
8	O43035	0.012	38.1	275	0.159	0.127	ATG3_SCHPO Autophagy-related protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg3 PE=3 SV=1
9	P40344	0.042	36.6	310	0.100	0.071	ATG3_YEAST Autophagy-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG3 PE=1 SV=1
10	Q9CPX6	0.12	35.4	314	0.141	0.099	ATG3_MOUSE Ubiquitin-like-conjugating enzyme ATG3 OS=Mus musculus OX=10090 GN=Atg3 PE=1 SV=1
11	Q9NT62	0.14	35.0	314	0.141	0.099	ATG3_HUMAN Ubiquitin-like-conjugating enzyme ATG3 OS=Homo sapiens OX=9606 GN=ATG3 PE=1 SV=1
12	Q6AZ50	0.15	35.0	314	0.127	0.089	ATG3_RAT Ubiquitin-like-conjugating enzyme ATG3 OS=Rattus norvegicus OX=10116 GN=Atg3 PE=2 SV=1
13	Q586I8	0.74	32.7	292	0.095	0.072	Q586I8_TRYB2 Autophagocytosis associated protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.320 PE=3 SV=1
14	B2ZGJ1	2.1	31.6	637	0.118	0.041	CLAT_DANRE Choline O-acetyltransferase OS=Danio rerio OX=7955 GN=chat PE=2 SV=1
15	Q9FVT9	6.7	29.6	172	0.082	0.105	Q9FVT9_ARATH Disease resistance protein RPP1-WsB, putative OS=Arabidopsis thaliana OX=3702 GN=At1g57630 PE=4 SV=1
16	Q8CB49	7.6	29.6	279	0.136	0.108	TPRG1_MOUSE Tumor protein p63-regulated gene 1 protein OS=Mus musculus OX=10090 GN=Tprg1 PE=2 SV=1
17	Q5BEJ7	8.6	29.6	440	0.050	0.025	AFOD_EMENI FAD-dependent monooxygenase afoD OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afoD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03987 Autophagy_act_C	2.1e-34	130.8	Autophagocytosis associated protein, active-site domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282185

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346437	0.999	Ubiquitin-like modifier-activating enzyme ATG7
2	9606.ENSP00000425107	0.999	Ubiquitin-like protein ATG12
3	9606.ENSP00000358072	0.998	Autophagy protein 5
4	9606.ENSP00000375872	0.988	Autophagy-related protein 16-1
5	9606.ENSP00000283290	0.974	Ubiquitin-like-conjugating enzyme ATG3
6	9606.ENSP00000037243	0.946	Gamma-aminobutyric acid receptor-associated protein-like 2
7	9606.ENSP00000266458	0.946	Gamma-aminobutyric acid receptor-associated protein-like 1
8	9606.ENSP00000432412	0.921	Autophagy-related protein 13
9	9606.ENSP00000306866	0.915	Gamma-aminobutyric acid receptor-associated protein
10	9606.ENSP00000268607	0.913	Microtubule-associated proteins 1A/1B light chain 3B
11	9606.ENSP00000262039	0.906	Phosphatidylinositol 3-kinase catalytic subunit type 3
12	9606.ENSP00000355231	0.906	Beclin-1
13	9606.ENSP00000363970	0.901	Microtubule-associated proteins 1A/1B light chain 3A
14	9606.ENSP00000349205	0.898	Phosphoinositide 3-kinase regulatory subunit 4
15	9606.ENSP00000338990	0.895	Autophagy-related protein 101
16	9606.ENSP00000025008	0.893	RB1-inducible coiled-coil protein 1
17	9606.ENSP00000349785	0.890	Microtubule-associated proteins 1A/1B light chain 3C
18	9606.ENSP00000247178	0.856	Beclin 1-associated autophagy-related key regulator
19	9606.ENSP00000384259	0.853	Cysteine protease ATG4B
20	9606.ENSP00000262139	0.830	WD repeat domain phosphoinositide-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.976	catalytic activity, acting on a protein
GO:0019787	0.963	ubiquitin-like protein transferase activity
GO:0019777	0.503	Atg12 transferase activity
GO:0061650	0.464	ubiquitin-like protein conjugating enzyme activity
GO:0061651	0.305	Atg12 conjugating enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0043412	0.995	macromolecule modification
GO:0044237	0.993	cellular metabolic process
GO:0050789	0.990	regulation of biological process
GO:0036211	0.990	protein modification process
GO:0061919	0.986	process utilizing autophagic mechanism
GO:0050896	0.965	response to stimulus
GO:0050794	0.965	regulation of cellular process
GO:0007154	0.962	cell communication
GO:0006914	0.939	autophagy
GO:0051716	0.920	cellular response to stimulus
GO:0033554	0.911	cellular response to stress
GO:0019222	0.645	regulation of metabolic process
GO:0048518	0.550	positive regulation of biological process
GO:0009893	0.393	positive regulation of metabolic process
GO:0080090	0.377	regulation of primary metabolic process
GO:0060255	0.375	regulation of macromolecule metabolic process
GO:0071840	0.367	cellular component organization or biogenesis
GO:0070647	0.337	protein modification by small protein conjugation or removal
GO:0016043	0.334	cellular component organization
GO:0016236	0.334	macroautophagy
GO:0051171	0.330	regulation of nitrogen compound metabolic process
GO:0034976	0.319	response to endoplasmic reticulum stress
GO:0032446	0.315	protein modification by small protein conjugation
GO:0023052	0.300	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0016020	0.520	membrane
GO:0012505	0.486	endomembrane system
GO:0043231	0.470	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.963	Transferases.

[back to server]