StarFunc result for job id Q9H0Z9

User Input

>input (239 residues)
MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDI
EEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQT
GFAIGVQQLHPTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYA
QYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0Z9	1.000	1.000	2.309E-38	239	1.000	1.000	Q9H0Z9.pdb.gz	RBM38_HUMAN RNA-binding protein 38 OS=Homo sapiens OX=9606 GN=RBM38 PE=1 SV=2
2	AFDB:Q76LC6	0.403	0.418	5.581E-25	230	0.640	0.665	Q76LC6.pdb.gz	RBM24_DANRE RNA-binding protein 24 OS=Danio rerio OX=7955 GN=rbm24 PE=2 SV=1
3	AFDB:A8KAI7	0.379	0.383	1.566E-24	236	0.678	0.686	A8KAI7.pdb.gz	A8KAI7_HUMAN RNA binding motif protein 24, isoform CRA_a OS=Homo sapiens OX=9606 GN=RBM24 PE=2 SV=1
4	AFDB:E9QCG4	0.433	0.423	2.348E-23	245	0.653	0.637	E9QCG4.pdb.gz	E9QCG4_DANRE RNA-binding motif protein 24b OS=Danio rerio OX=7955 GN=zgc:136803 PE=4 SV=1
5	AFDB:O45189	0.381	0.367	2.573E-18	248	0.389	0.375	O45189.pdb.gz	O45189_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-12 PE=1 SV=1
6	AFDB:F4HUQ5	0.380	0.336	1.933E-16	274	0.372	0.325	F4HUQ5.pdb.gz	F4HUQ5_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g20880 PE=1 SV=1
7	AFDB:Q67YS0	0.361	0.352	7.018E-16	245	0.360	0.351	Q67YS0.pdb.gz	Q67YS0_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g33470 PE=1 SV=1
8	AFDB:F4I2E4	0.369	0.311	8.516E-16	285	0.360	0.302	F4I2E4.pdb.gz	F4I2E4_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g76460 PE=1 SV=1
9	AFDB:F4I321	0.395	0.277	3.297E-15	347	0.331	0.228	F4I321.pdb.gz	F4I321_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22910 PE=1 SV=1
10	AFDB:Q9M1S3	0.374	0.344	7.148E-15	261	0.318	0.291	Q9M1S3.pdb.gz	ARP1_ARATH Probable RNA-binding protein ARP1 OS=Arabidopsis thaliana OX=3702 GN=ARP1 PE=2 SV=1
11	PDB:6qx91K	0.328	0.387	8.013E-8	201	0.117	0.139	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:6g90B	0.328	0.403	1.258E-7	193	0.130	0.161	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
13	PDB:6n7pA	0.319	0.405	5.197E-7	186	0.113	0.145	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
14	PDB:7dvqY	0.312	0.520	8.704E-7	140	0.117	0.200	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:7ohxo	0.298	0.616	9.284E-7	112	0.100	0.214	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
16	PDB:5yzg1	0.309	0.304	1.887E-6	243	0.113	0.111	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
17	PDB:6c0fo	0.307	0.534	2.146E-6	133	0.121	0.218	6c0fo.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
18	PDB:6zmwo	0.292	0.849	4.362E-6	77	0.092	0.286	6zmwo.pdb.gz	Structure of a human 48Stranslational initiation complex.
19	PDB:6y53o	0.307	0.450	6.850E-6	160	0.100	0.150	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
20	PDB:7oqcF	0.276	0.249	8.865E-6	267	0.172	0.154	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H0Z9	9.34e-173	476	239	1.000	1.000	RBM38_HUMAN RNA-binding protein 38 OS=Homo sapiens OX=9606 GN=RBM38 PE=1 SV=2
2	Q62176	1.47e-145	407	237	0.946	0.954	RBM38_MOUSE RNA-binding protein 38 OS=Mus musculus OX=10090 GN=Rbm38 PE=1 SV=2
3	Q6GQD3	2.74e-86	257	225	0.653	0.693	RB24A_XENLA RNA-binding protein 24-A OS=Xenopus laevis OX=8355 GN=rbm24-a PE=2 SV=1
4	M0R7T6	1.12e-83	251	236	0.665	0.674	RBM24_RAT RNA-binding protein 24 OS=Rattus norvegicus OX=10116 GN=Rbm24 PE=3 SV=4
5	D3Z4I3	3.33e-83	249	236	0.510	0.517	RBM24_MOUSE RNA-binding protein 24 OS=Mus musculus OX=10090 GN=Rbm24 PE=1 SV=1
6	A8KAI7	1.53e-82	248	236	0.506	0.513	A8KAI7_HUMAN RNA binding motif protein 24, isoform CRA_a OS=Homo sapiens OX=9606 GN=RBM24 PE=2 SV=1
7	Q9BX46	1.53e-82	248	236	0.506	0.513	RBM24_HUMAN RNA-binding protein 24 OS=Homo sapiens OX=9606 GN=RBM24 PE=1 SV=1
8	Q5ZMA3	7.53e-82	246	225	0.506	0.538	RBM24_CHICK RNA-binding protein 24 OS=Gallus gallus OX=9031 GN=RBM24 PE=1 SV=2
9	Q76LC6	3.44e-81	244	230	0.615	0.639	RBM24_DANRE RNA-binding protein 24 OS=Danio rerio OX=7955 GN=rbm24 PE=2 SV=1
10	E9QCG4	3.12e-75	229	245	0.490	0.478	E9QCG4_DANRE RNA-binding motif protein 24b OS=Danio rerio OX=7955 GN=zgc:136803 PE=4 SV=1
11	H2L051	1.25e-52	169	151	0.318	0.503	H2L051_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-12 PE=1 SV=1
12	O45189	2.39e-51	169	248	0.318	0.306	O45189_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-12 PE=1 SV=1
13	H0Y8S7	6.37e-42	143	201	0.310	0.368	H0Y8S7_HUMAN RNA binding motif protein 24 (Fragment) OS=Homo sapiens OX=9606 GN=RBM24 PE=1 SV=1
14	Q67YS0	4.23e-34	124	245	0.243	0.237	Q67YS0_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g33470 PE=1 SV=1
15	F4I2E4	9.09e-33	122	285	0.234	0.196	F4I2E4_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g76460 PE=1 SV=1
16	Q501B0	3.93e-32	121	336	0.234	0.167	Q501B0_ARATH At2g46780 OS=Arabidopsis thaliana OX=3702 GN=At2g46780 PE=1 SV=1
17	F4HUQ5	6.06e-31	117	274	0.360	0.314	F4HUQ5_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g20880 PE=1 SV=1
18	Q8LF90	1.06e-30	116	287	0.209	0.174	Q8LF90_ARATH At1g78260 OS=Arabidopsis thaliana OX=3702 GN=At1g78260 PE=1 SV=1
19	Q9LME7	1.92e-30	116	291	0.222	0.182	Q9LME7_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22330 PE=1 SV=1
20	F4I321	1.40e-28	112	347	0.205	0.141	F4I321_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22910 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	8.7e-15	65.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF16367 RRM_7	2.9	19.4	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348538

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385269	0.909	ELAV-like protein 1
2	9606.ENSP00000418748	0.727	Epithelial splicing regulatory protein 2
3	9606.ENSP00000415579	0.715	Transcriptional repressor CTCFL
4	9606.ENSP00000425561	0.715	Eukaryotic translation initiation factor 4E
5	9606.ENSP00000416255	0.704	Eukaryotic translation initiation factor 4 gamma 1
6	9606.ENSP00000319814	0.684	Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
7	9606.ENSP00000360054	0.678	Phosphatase and actin regulator 3
8	9606.ENSP00000220592	0.672	Protein argonaute-2
9	9606.ENSP00000311513	0.662	Remodeling and spacing factor 1
10	9606.ENSP00000367545	0.638	Tumor protein p73
11	9606.ENSP00000420514	0.633	BAG family molecular chaperone regulator 1
12	9606.ENSP00000229390	0.617	Serine/arginine-rich splicing factor 9
13	9606.ENSP00000266529	0.602	Zinc finger CCHC-type and RNA binding motif containing 1
14	9606.ENSP00000413035	0.597	RNA binding protein fox-1 homolog 2
15	9606.ENSP00000064571	0.573	Cerebellin-4
16	9606.ENSP00000264731	0.573	Tumor protein 63
17	9606.ENSP00000417196	0.558	Poly(rC)-binding protein 4
18	9606.ENSP00000386894	0.551	RNA-binding protein 4
19	9606.ENSP00000416959	0.545	Transformer-2 protein homolog beta
20	9606.ENSP00000216780	0.540	Phosphoenolpyruvate carboxykinase [GTP], mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003729	1.000	mRNA binding
GO:0005515	0.999	protein binding
GO:0003730	0.614	mRNA 3'-UTR binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.980	cellular process
GO:0051147	0.953	regulation of muscle cell differentiation
GO:0019222	0.950	regulation of metabolic process
GO:0051171	0.920	regulation of nitrogen compound metabolic process
GO:0060255	0.894	regulation of macromolecule metabolic process
GO:0051153	0.889	regulation of striated muscle cell differentiation
GO:0080090	0.843	regulation of primary metabolic process
GO:0031323	0.841	regulation of cellular metabolic process
GO:0008152	0.831	metabolic process
GO:0010830	0.816	regulation of myotube differentiation
GO:0071704	0.807	organic substance metabolic process
GO:0019219	0.800	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.797	regulation of gene expression
GO:0051252	0.724	regulation of RNA metabolic process
GO:0044237	0.705	cellular metabolic process
GO:0006807	0.678	nitrogen compound metabolic process
GO:0048518	0.669	positive regulation of biological process
GO:0044238	0.638	primary metabolic process
GO:0009894	0.623	regulation of catabolic process
GO:0050896	0.601	response to stimulus
GO:1903311	0.601	regulation of mRNA metabolic process
GO:0048522	0.584	positive regulation of cellular process
GO:0043170	0.579	macromolecule metabolic process
GO:0048519	0.546	negative regulation of biological process
GO:0043484	0.511	regulation of RNA splicing
GO:0048523	0.500	negative regulation of cellular process
GO:0010604	0.477	positive regulation of macromolecule metabolic process
GO:0010605	0.468	negative regulation of macromolecule metabolic process
GO:0034641	0.425	cellular nitrogen compound metabolic process
GO:0010608	0.401	post-transcriptional regulation of gene expression
GO:0006725	0.393	cellular aromatic compound metabolic process
GO:0090304	0.368	nucleic acid metabolic process
GO:0031329	0.367	regulation of cellular catabolic process
GO:0051172	0.361	negative regulation of nitrogen compound metabolic process
GO:0031324	0.361	negative regulation of cellular metabolic process
GO:0016070	0.346	RNA metabolic process
GO:0010467	0.332	gene expression
GO:0051716	0.331	cellular response to stimulus
GO:0009889	0.303	regulation of biosynthetic process
GO:0045934	0.303	negative regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.998	cytosol
GO:0070013	0.977	intracellular organelle lumen
GO:0005654	0.967	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]