StarFunc result for job id Q9H115

User Input

>input (298 residues)
MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAANMFKMAKNWSA
AGNAFCQAAKLHMQLQSKHDSATSFVDAGNAYKKADPQEAINCLNAAIDIYTDMGRFTIA
AKHHITIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAAYAAQLEQYQK
AIEIYEQVGANTMDNPLLKYSAKDYFFKAALCHFIVDELNAKLALEKYEEMFPAFTDSRE
CKLLKKLLEAHEEQNSEAYTEAVKEFDSISRLDQWLTTMLLRIKKSIQGDGEGDGDLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28663	1.000	1.000	1.609E-36	298	1.000	1.000	P28663.pdb.gz	SNAB_MOUSE Beta-soluble NSF attachment protein OS=Mus musculus OX=10090 GN=Napb PE=1 SV=2
2	AFDB:A1L245	0.975	0.985	3.120E-32	295	0.852	0.861	A1L245.pdb.gz	A1L245_DANRE Zgc:158643 OS=Danio rerio OX=7955 GN=zgc:158643 PE=2 SV=1
3	AFDB:P54920	0.967	0.977	4.398E-32	295	0.822	0.831	P54920.pdb.gz	SNAA_HUMAN Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3
4	AFDB:Q23983	0.932	0.951	1.138E-25	292	0.611	0.623	Q23983.pdb.gz	SNAP_DROME Alpha-soluble NSF attachment protein OS=Drosophila melanogaster OX=7227 GN=alphaSnap PE=1 SV=1
5	PDB:6ip1E	0.865	0.881	1.327E-21	292	0.795	0.812	6ip1E.pdb.gz
6	AFDB:Q54NP6	0.916	0.937	1.858E-21	291	0.436	0.447	Q54NP6.pdb.gz	SNAA_DICDI Alpha-soluble NSF attachment protein OS=Dictyostelium discoideum OX=44689 GN=snpA PE=1 SV=1
7	AFDB:Q9SPE6	0.900	0.928	4.521E-19	289	0.399	0.412	Q9SPE6.pdb.gz	SNAA2_ARATH Alpha-soluble NSF attachment protein 2 OS=Arabidopsis thaliana OX=3702 GN=ASNAP2 PE=1 SV=1
8	AFDB:Q9P4X4	0.888	0.914	9.378E-19	289	0.356	0.367	Q9P4X4.pdb.gz	SEC17_SCHPO Probable vesicular-fusion protein sec17 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec17 PE=1 SV=1
9	AFDB:P32602	0.876	0.893	1.690E-16	292	0.326	0.332	P32602.pdb.gz	SEC17_YEAST Alpha-soluble NSF attachment protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC17 PE=1 SV=4
10	PDB:1qqeA	0.852	0.901	5.834E-14	281	0.309	0.327	1qqeA.pdb.gz
11	AFDB:Q4GYR2	0.792	0.836	3.368E-13	281	0.275	0.292	Q4GYR2.pdb.gz	Q4GYR2_TRYB2 Soluble N-ethylmaleimide sensitive factor (NSF) attachment protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3110 PE=3 SV=1
12	AFDB:Q381H8	0.782	0.794	9.581E-12	293	0.228	0.232	Q381H8.pdb.gz	Q381H8_TRYB2 Soluble N-ethylmaleimide sensitive factor (NSF) attachment protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7740 PE=3 SV=1
13	PDB:6ez8B	0.697	0.768	1.848E-5	268	0.141	0.157	6ez8B.pdb.gz
14	PDB:3q15A	0.384	0.325	2.134E-4	365	0.161	0.132	3q15A.pdb.gz	Structural basis of response regulator dephosphorylation by Rap phosphatases.
15	PDB:4gyoB	0.357	0.307	3.892E-4	359	0.117	0.097	4gyoB.pdb.gz	Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
16	PDB:7ru9C	0.365	0.387	3.892E-4	271	0.128	0.140	7ru9C.pdb.gz	Structural insights into metazoan pretargeting GET complexes.
17	PDB:2y4uA	0.281	0.217	4.241E-4	424	0.174	0.123	2y4uA.pdb.gz
18	PDB:5mpbQ	0.486	0.352	4.824E-4	434	0.104	0.071	5mpbQ.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
19	PDB:4bujB	0.291	0.092	5.979E-4	1367	0.104	0.023	4bujB.pdb.gz
20	PDB:7ntfA	0.160	0.080	6.514E-4	918	0.161	0.052	7ntfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L245	0.0	545	295	0.866	0.875	A1L245_DANRE Zgc:158643 OS=Danio rerio OX=7955 GN=zgc:158643 PE=2 SV=1
2	F1Q9P4	0.0	552	295	0.876	0.885	F1Q9P4_DANRE Beta-soluble NSF attachment protein OS=Danio rerio OX=7955 GN=beta-snap1 PE=1 SV=1
3	P28663	0.0	615	298	1.000	1.000	SNAB_MOUSE Beta-soluble NSF attachment protein OS=Mus musculus OX=10090 GN=Napb PE=1 SV=2
4	P54920	0.0	503	295	0.826	0.834	SNAA_HUMAN Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3
5	P54921	0.0	503	295	0.815	0.824	SNAA_RAT Alpha-soluble NSF attachment protein OS=Rattus norvegicus OX=10116 GN=Napa PE=1 SV=2
6	P85969	0.0	609	297	0.997	1.000	SNAB_RAT Beta-soluble NSF attachment protein OS=Rattus norvegicus OX=10116 GN=Napb PE=1 SV=1
7	Q9DB05	0.0	506	295	0.822	0.831	SNAA_MOUSE Alpha-soluble NSF attachment protein OS=Mus musculus OX=10090 GN=Napa PE=1 SV=1
8	Q9H115	0.0	615	298	1.000	1.000	SNAB_HUMAN Beta-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPB PE=1 SV=2
9	P81125	1.66e-180	501	295	0.822	0.831	SNAA_BOVIN Alpha-soluble NSF attachment protein OS=Bos taurus OX=9913 GN=NAPA PE=1 SV=1
10	Q23983	8.66e-131	375	292	0.607	0.620	SNAP_DROME Alpha-soluble NSF attachment protein OS=Drosophila melanogaster OX=7227 GN=alphaSnap PE=1 SV=1
11	Q54NP6	8.89e-87	263	291	0.443	0.454	SNAA_DICDI Alpha-soluble NSF attachment protein OS=Dictyostelium discoideum OX=44689 GN=snpA PE=1 SV=1
12	Q9SPE6	6.08e-73	228	289	0.393	0.405	SNAA2_ARATH Alpha-soluble NSF attachment protein 2 OS=Arabidopsis thaliana OX=3702 GN=ASNAP2 PE=1 SV=1
13	Q9P4X4	3.20e-62	200	289	0.356	0.367	SEC17_SCHPO Probable vesicular-fusion protein sec17 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec17 PE=1 SV=1
14	P32602	5.40e-46	158	292	0.329	0.336	SEC17_YEAST Alpha-soluble NSF attachment protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC17 PE=1 SV=4
15	Q9LXZ5	4.78e-31	121	381	0.299	0.234	SNAA1_ARATH Alpha-soluble NSF attachment protein 1 OS=Arabidopsis thaliana OX=3702 GN=ASNAP1 PE=1 SV=1
16	Q4GYR2	8.74e-26	105	281	0.255	0.270	Q4GYR2_TRYB2 Soluble N-ethylmaleimide sensitive factor (NSF) attachment protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3110 PE=3 SV=1
17	Q381H8	2.01e-14	74.3	293	0.232	0.235	Q381H8_TRYB2 Soluble N-ethylmaleimide sensitive factor (NSF) attachment protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7740 PE=3 SV=1
18	Q9CWZ7	5.57e-06	49.3	312	0.242	0.231	SNAG_MOUSE Gamma-soluble NSF attachment protein OS=Mus musculus OX=10090 GN=Napg PE=1 SV=1
19	A0A0G2K350	6.75e-06	49.3	312	0.242	0.231	A0A0G2K350_RAT NSF attachment protein gamma OS=Rattus norvegicus OX=10116 GN=Napg PE=3 SV=1
20	Q6FHY4	3.27e-04	43.9	312	0.235	0.224	Q6FHY4_HUMAN N-ethylmaleimide-sensitive factor attachment protein, gamma, isoform CRA_b OS=Homo sapiens OX=9606 GN=NAPG PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09920 DUF2150	88	14.5	Uncharacterized protein conserved in archaea (DUF2150)
2	PF14938 SNAP	7.6e-107	368.5	Soluble NSF attachment protein, SNAP
3	PF14649 Spatacsin_C	1.2	19.7	Spatacsin C-terminus
4	PF13424 TPR_12	0.00074	31.1	Tetratricopeptide repeat
5	PF13432 TPR_16	35	16.4	Tetratricopeptide repeat
6	PF13174 TPR_6	1e+02	15.0	Tetratricopeptide repeat
7	PF13176 TPR_7	9	17.6	Tetratricopeptide repeat
8	PF13181 TPR_8	63	15.2	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010606540.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010614304.1	0.986	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns
2	885580.XP_010631390.1	0.981	Syntaxin-3 isoform X1
3	885580.XP_010617312.1	0.978	syntaxin-1A
4	885580.XP_010615740.1	0.976	Belongs to the syntaxin family.
5	885580.XP_010613322.1	0.974	Vesicle-associated membrane protein 2
6	885580.XP_010632914.1	0.972	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 11 samples with support for all annotated introns
7	885580.XP_010631270.1	0.969	Belongs to the syntaxin family.
8	885580.XP_010623987.1	0.967	Vesicle-associated membrane protein 8
9	885580.XP_010619116.1	0.965	Synaptosomal-associated protein 29
10	885580.XP_010621425.1	0.964	Vesicle-trafficking protein SEC22b
11	885580.XP_010623085.1	0.964	Synaptosomal-associated protein 23 isoform X1
12	885580.XP_010643298.1	0.960	Vesicle-associated membrane protein 4 isoform X1
13	885580.XP_010639129.1	0.958	Alpha-soluble NSF attachment protein
14	885580.XP_010613274.1	0.957	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
15	885580.XP_010643933.1	0.956	Vesicle transport through interaction with t-SNAREs homolog 1B
16	885580.XP_010628586.1	0.951	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
17	885580.XP_010627070.1	0.947	Syntaxin-16 isoform X1
18	885580.XP_010637418.1	0.947	Syntaxin-7 isoform X1
19	885580.XP_010623240.1	0.945	Belongs to the synaptobrevin family.
20	885580.XP_010635751.1	0.941	Vesicle-fusing ATPase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019905	1.000	syntaxin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0065007	0.991	biological regulation
GO:0050794	0.958	regulation of cellular process
GO:0016043	0.916	cellular component organization
GO:0006810	0.915	transport
GO:0016192	0.910	vesicle-mediated transport
GO:0051641	0.833	cellular localization
GO:0022411	0.797	cellular component disassembly
GO:0043933	0.791	protein-containing complex organization
GO:0032984	0.742	protein-containing complex disassembly
GO:0065009	0.725	regulation of molecular function
GO:0051128	0.717	regulation of cellular component organization
GO:0099003	0.654	vesicle-mediated transport in synapse
GO:0043462	0.624	regulation of ATP-dependent activity
GO:0032879	0.551	regulation of localization
GO:0051649	0.518	establishment of localization in cell
GO:0023052	0.456	signaling
GO:0032501	0.448	multicellular organismal process
GO:0007154	0.446	cell communication
GO:0099504	0.416	synaptic vesicle cycle
GO:0007268	0.392	chemical synaptic transmission
GO:0051049	0.341	regulation of transport
GO:0065008	0.324	regulation of biological quality
GO:0032940	0.306	secretion by cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043227	0.998	membrane-bounded organelle
GO:0098793	0.980	presynapse
GO:0005886	0.978	plasma membrane
GO:0043229	0.977	intracellular organelle
GO:0043231	0.961	intracellular membrane-bounded organelle
GO:0032991	0.938	protein-containing complex
GO:0012505	0.937	endomembrane system
GO:0031201	0.925	SNARE complex
GO:0031982	0.897	vesicle
GO:0031410	0.860	cytoplasmic vesicle
GO:0043005	0.818	neuron projection
GO:0098978	0.807	glutamatergic synapse
GO:0043209	0.700	myelin sheath
GO:0005829	0.616	cytosol
GO:0098590	0.432	plasma membrane region
GO:0005576	0.387	extracellular region
GO:0030424	0.380	axon
GO:0098794	0.345	postsynapse
GO:0097060	0.342	synaptic membrane
GO:0048786	0.327	presynaptic active zone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]