StarFunc result for job id Q9H147

User Input

>input (329 residues)
MGATGDAEQPRGPSGAERGGLELGDAGAAGQLVLTNPWNIMIKHRQVQRRGRRSQMTTSF
TDPAISMDLLRAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRS
CLEQAKLLFSDGEKVIPRLTHELPGIKRGRQAEEECAHRGSPLPKKRKGRPPGHILSSDR
AAAGMVWKPKSCEPIRREGPKWDPARLNESTTFVLGSRANKALGMGGTRGRIYIKHPHLF
KYAADPQDKHWLAEQHHMRATGGKMAYLLIEEDIRDLAASDDYRGCLDLKLEELKSFVLP
SWMVEKMRKYMETLRTENEHRAVEAPPQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H147	1.000	1.000	4.736E-53	329	1.000	1.000	Q9H147.pdb.gz	TDIF1_HUMAN Deoxynucleotidyltransferase terminal-interacting protein 1 OS=Homo sapiens OX=9606 GN=DNTTIP1 PE=1 SV=2
2	AFDB:Q03615	0.302	0.324	3.011E-11	305	0.176	0.190	Q03615.pdb.gz	SAEG2_CAEEL Suppressor of activated egl-4 protein 2 OS=Caenorhabditis elegans OX=6239 GN=saeg-2 PE=1 SV=2
3	AFDB:Q8WUB8	0.214	0.146	1.468E-3	498	0.085	0.056	Q8WUB8.pdb.gz	PHF10_HUMAN PHD finger protein 10 OS=Homo sapiens OX=9606 GN=PHF10 PE=1 SV=3
4	AFDB:Q9VAF3	0.091	0.086	9.715E-2	352	0.109	0.102	Q9VAF3.pdb.gz	Q9VAF3_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7824 PE=1 SV=1
5	AFDB:O64903	0.146	0.182	2.195E-1	231	0.085	0.121	O64903.pdb.gz	NDK2_ARATH Nucleoside diphosphate kinase II, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NDPK2 PE=1 SV=2
6	AFDB:C9JSZ1	0.141	0.180	3.708E-1	232	0.067	0.095	C9JSZ1.pdb.gz	C9JSZ1_HUMAN Far upstream element binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=2
7	PDB:6lthM	0.185	0.232	4.310E-1	259	0.036	0.046	6lthM.pdb.gz	Structure of nucleosome-bound human BAF complex.
8	PDB:6xbya	0.117	0.088	6.867E-1	494	0.043	0.028	6xbya.pdb.gz	Cryo-EM structures of intact V-ATPase from bovine brain.
9	PDB:7kpfA	0.163	0.263	1.160	152	0.040	0.086	7kpfA.pdb.gz	A Chemical Proteomic Approach reveals the regulation of NME1/2 and cancer metastasis by Long-Chain Fatty Acyl Coenzyme A
10	AFDB:Q9VJL5	0.094	0.068	1.415	570	0.109	0.063	Q9VJL5.pdb.gz	Q9VJL5_DROME Crossover suppressor on 2 of manheim OS=Drosophila melanogaster OX=7227 GN=c(2)M PE=2 SV=2
11	AFDB:Q9HUB4	0.109	0.215	1.500	141	0.073	0.170	Q9HUB4.pdb.gz	TATB_PSEAE Sec-independent protein translocase protein TatB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=tatB PE=3 SV=1
12	PDB:4al5A	0.124	0.186	1.552	189	0.055	0.095	4al5A.pdb.gz	Csy4 Relies on an Unusual Catalytic Dyad to Position and Cleave Crispr RNA.
13	PDB:7o9kI	0.102	0.142	1.848	212	0.088	0.137	7o9kI.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
14	AFDB:Q5XVH0	0.107	0.166	2.007	185	0.058	0.103	Q5XVH0.pdb.gz	BH109_ARATH Transcription factor bHLH109 OS=Arabidopsis thaliana OX=3702 GN=BHLH109 PE=1 SV=1
15	PDB:2zbkB	0.108	0.077	2.473	506	0.021	0.014	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms
16	AFDB:A0A087WYZ9	0.114	0.066	2.533	719	0.091	0.042	A0A087WYZ9.pdb.gz	A0A087WYZ9_HUMAN Histone-lysine N-methyltransferase SETDB2 OS=Homo sapiens OX=9606 GN=SETDB2 PE=1 SV=1
17	PDB:3l7uB	0.159	0.256	3.308	154	0.046	0.097	3l7uB.pdb.gz
18	PDB:5k1yD	0.085	0.154	3.507	92	0.046	0.163	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
19	PDB:1z6gA	0.094	0.130	3.717	191	0.036	0.063	1z6gA.pdb.gz
20	PDB:6lkeA	0.131	0.106	4.426	428	0.049	0.037	6lkeA.pdb.gz	Full-length in meso structure and mechanism of rat kynurenine 3-monooxygenase inhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7C1M5	0.0	564	280	0.848	0.996	H7C1M5_HUMAN Deoxynucleotidyltransferase terminal-interacting protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=DNTTIP1 PE=1 SV=1
2	Q9H147	0.0	684	329	1.000	1.000	TDIF1_HUMAN Deoxynucleotidyltransferase terminal-interacting protein 1 OS=Homo sapiens OX=9606 GN=DNTTIP1 PE=1 SV=2
3	Q03615	1.98e-15	77.8	305	0.222	0.239	SAEG2_CAEEL Suppressor of activated egl-4 protein 2 OS=Caenorhabditis elegans OX=6239 GN=saeg-2 PE=1 SV=2
4	F4I4P3	0.053	38.1	1615	0.112	0.023	MED23_ARATH Mediator of RNA polymerase II transcription subunit 23 OS=Arabidopsis thaliana OX=3702 GN=MED23 PE=1 SV=1
5	Q9NVS2	1.4	32.3	196	0.064	0.107	RT18A_HUMAN Large ribosomal subunit protein mL66 OS=Homo sapiens OX=9606 GN=MRPS18A PE=1 SV=1
6	O94346	2.4	32.3	445	0.085	0.063	ARGJ_SCHPO Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1271.14 PE=3 SV=1
7	Q8VZ21	4.7	31.6	475	0.094	0.065	Q8VZ21_ARATH Stress up-regulated Nod 19 protein OS=Arabidopsis thaliana OX=3702 GN=MAC9.6 PE=1 SV=1
8	Q57YY8	4.8	31.6	4674	0.070	0.005	Q57YY8_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.260 PE=4 SV=1
9	Q9S814	5.3	31.6	1294	0.085	0.022	EIN2_ARATH Ethylene-insensitive protein 2 OS=Arabidopsis thaliana OX=3702 GN=EIN2 PE=1 SV=1
10	O42700	7.0	30.8	322	0.082	0.084	TAL1_SCHPO Transaldolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tal1 PE=1 SV=2
11	Q99N85	8.1	30.0	196	0.064	0.107	RT18A_MOUSE Large ribosomal subunit protein mL66 OS=Mus musculus OX=10090 GN=Mrps18a PE=2 SV=1
12	Q5DTK1	8.7	30.8	884	0.079	0.029	CHSS3_MOUSE Chondroitin sulfate synthase 3 OS=Mus musculus OX=10090 GN=Chsy3 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18192 DNTTIP1_dimer	9.8e-26	101.3	DNTTIP1 dimerisation domain
2	PF14328 DUF4385	4.7e+02	12.3	Domain of unknown function (DUF4385)
3	PF17279 DUF5344	2.5e+02	13.6	Family of unknown function (DUF5344)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361705

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.978	Histone deacetylase 1
2	9606.ENSP00000286523	0.967	ELM2 and Myb/SANT domain containing 1
3	9606.ENSP00000439689	0.931	Transcriptional-regulating factor 1
4	9606.ENSP00000360216	0.853	DNA nucleotidylexotransferase
5	9606.ENSP00000411010	0.798	Deoxynucleotidyltransferase terminal-interacting protein 2
6	9606.ENSP00000375770	0.749	Zinc finger protein 541
7	9606.ENSP00000325296	0.694	Polycystic kidney disease 2-like 1 protein
8	9606.ENSP00000430432	0.674	Histone deacetylase 2
9	9606.ENSP00000437621	0.674	High mobility group protein HMGI-C
10	9606.ENSP00000348838	0.646	Ubiquitin-conjugating enzyme E2 C
11	9606.ENSP00000232744	0.587	Ankyrin repeat and BTB/POZ domain-containing protein 1
12	9606.ENSP00000302938	0.577	WAP four-disulfide core domain protein 13
13	9606.ENSP00000243938	0.524	WAP four-disulfide core domain containing
14	9606.ENSP00000279058	0.522	Serine peptidase inhibitor, Kunitz type 4
15	9606.ENSP00000371529	0.519	Uncharacterized protein C22orf42
16	9606.ENSP00000267328	0.515	Ras-related protein Rab-20
17	9606.ENSP00000267103	0.510	UPF0160 protein MYG1, mitochondrial
18	9606.ENSP00000337466	0.502	Protein WFDC10B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031491	1.000	nucleosome binding
GO:0042803	1.000	protein homodimerization activity
GO:0003677	1.000	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.975	regulation of biological process
GO:0009987	0.974	cellular process
GO:0050794	0.952	regulation of cellular process
GO:0019222	0.952	regulation of metabolic process
GO:0008152	0.869	metabolic process
GO:0044238	0.845	primary metabolic process
GO:2001141	0.820	regulation of RNA biosynthetic process
GO:0071704	0.818	organic substance metabolic process
GO:1903506	0.800	regulation of nucleic acid-templated transcription
GO:0006355	0.788	regulation of DNA-templated transcription
GO:0006807	0.787	nitrogen compound metabolic process
GO:0048518	0.685	positive regulation of biological process
GO:0044237	0.633	cellular metabolic process
GO:0048522	0.549	positive regulation of cellular process
GO:0048519	0.519	negative regulation of biological process
GO:0006357	0.511	regulation of transcription by RNA polymerase II
GO:0048523	0.473	negative regulation of cellular process
GO:0043170	0.405	macromolecule metabolic process
GO:0009893	0.405	positive regulation of metabolic process
GO:0010604	0.397	positive regulation of macromolecule metabolic process
GO:1901564	0.388	organonitrogen compound metabolic process
GO:0051173	0.335	positive regulation of nitrogen compound metabolic process
GO:0010605	0.313	negative regulation of macromolecule metabolic process
GO:0045934	0.308	negative regulation of nucleobase-containing compound metabolic process
GO:0031325	0.304	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005694	0.999	chromosome
GO:0005730	0.997	nucleolus
GO:0032991	0.988	protein-containing complex
GO:0140513	0.953	nuclear protein-containing complex
GO:1902494	0.935	catalytic complex
GO:0000118	0.726	histone deacetylase complex
GO:0005737	0.595	cytoplasm
GO:0005829	0.470	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]