StarFunc result for job id Q9H158

User Input

>input (963 residues)
MVGCGVAVLCLWVSCGAAAGQLEYSVPEETERGVAVGNLSADLRLPAAAMSSRNFRFLSS
HRELYFGVDLPSGNLVVREPADREQLCRAKAACVLTYDLVLEDPLELHKIRIHVLDTNDN
SPLFPAGDVQLHIPEFLTPGARFTLPNAQDDDEGSNGILSYSLSPSQHFRLDMGSRVDGS
EYPELVLEKALDREQRATHLLVLTARDGGLPARSGDAQVTIIVVDTNDNAPVFERSVYRT
KVPETAPNGTVLFRVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLG
PPETLLEAYIEARDEGVFGLASTAKLLVEVTDVNDHAPELDFLTLSNPVPEDAAPGTVIA
LFSVKDEDLDSNGRVICGMSSAGPFQLTASFDNYYSLLIDGPLDREQISEYQVLITASDS
GSPPLSTRRTITVSVADVNDNTPNFPQPQQELFVAENNGPGASLGRVFAQDPDLGKNGLV
SYELLDVISEGPSASSLLAVESSSGAITAKTSFDFEQLRGFHFQVEGRDGGIPPRSATVT
INLFVVDRNDNYPVILFPLPRNGSVPVEIVPRSARTGHLVTKVVAEDADSGSNAWLSYHI
SRASDSSLFRISANIGELRTARLVLPTDAVKQRVVVVVRDHGDPPLSSSVTLGVLLSNSV
PQLLPDFEDVWEPGGQLSAQNLYLVIALACISFLFLGCLLFFVCTKLHQSPGCCAQSCCR
STEDLRYGSKMVSNPCMTSATIDVTTVERLSQTYLYRASLGLGSDNNSLLLRGEYNAADL
RNLATGVGLNLPISCIQIRNRKGDHANVNAMPRQPNPDWRYSASLRAGMHSSVHLEEAGI
LRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDK
FIIPGSPAIISIRQEPTNSQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDN
SDQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H158	1.000	1.000	0.000	963	1.000	1.000	Q9H158.pdb.gz	PCDC1_HUMAN Protocadherin alpha-C1 OS=Homo sapiens OX=9606 GN=PCDHAC1 PE=2 SV=2
2	AFDB:Q6ZQD4	0.599	0.600	6.556E-101	962	0.478	0.478	Q6ZQD4.pdb.gz	Q6ZQD4_MOUSE MKIAA0345 protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdha3 PE=2 SV=1
3	AFDB:Q9Y5H9	0.537	0.544	2.422E-100	948	0.451	0.458	Q9Y5H9.pdb.gz	PCDA2_HUMAN Protocadherin alpha-2 OS=Homo sapiens OX=9606 GN=PCDHA2 PE=1 SV=1
4	AFDB:Q9Y5I3	0.572	0.578	3.115E-100	950	0.457	0.463	Q9Y5I3.pdb.gz	PCDA1_HUMAN Protocadherin alpha-1 OS=Homo sapiens OX=9606 GN=PCDHA1 PE=2 SV=1
5	AFDB:Q9Y5I2	0.555	0.563	6.621E-100	948	0.461	0.468	Q9Y5I2.pdb.gz	PCDAA_HUMAN Protocadherin alpha-10 OS=Homo sapiens OX=9606 GN=PCDHA10 PE=2 SV=1
6	AFDB:Q91Y21	0.548	0.555	1.636E-99	948	0.456	0.463	Q91Y21.pdb.gz	Q91Y21_MOUSE Protocadherin alpha 1 OS=Mus musculus OX=10090 GN=Pcdha1 PE=2 SV=1
7	AFDB:Q91Y20	0.543	0.552	3.146E-99	946	0.463	0.471	Q91Y20.pdb.gz	PCDAA_MOUSE Protocadherin alpha-10 OS=Mus musculus OX=10090 GN=Pcdha10 PE=2 SV=1
8	AFDB:O88690	0.549	0.557	3.658E-99	946	0.454	0.462	O88690.pdb.gz	O88690_MOUSE CNR2 OS=Mus musculus OX=10090 GN=Pcdha6 PE=2 SV=1
9	AFDB:Q9UN72	0.534	0.547	3.658E-99	937	0.474	0.487	Q9UN72.pdb.gz	PCDA7_HUMAN Protocadherin alpha-7 OS=Homo sapiens OX=9606 GN=PCDHA7 PE=2 SV=1
10	AFDB:Q9Y5H7	0.523	0.535	3.658E-99	936	0.464	0.478	Q9Y5H7.pdb.gz	PCDA5_HUMAN Protocadherin alpha-5 OS=Homo sapiens OX=9606 GN=PCDHA5 PE=2 SV=1
11	PDB:4aq1A	0.111	0.139	1.856E-13	721	0.080	0.107	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
12	PDB:6velC	0.176	0.707	4.872E-12	209	0.048	0.220	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:1e07A	0.144	0.190	1.089E-11	642	0.077	0.115	1e07A.pdb.gz
14	PDB:5oj2B	0.144	0.190	1.644E-10	692	0.085	0.118	5oj2B.pdb.gz
15	PDB:7nycA	0.098	0.067	2.290E-7	1542	0.083	0.052	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:4rtdA	0.079	0.070	7.653E-7	1122	0.073	0.062	4rtdA.pdb.gz
17	PDB:7q1yA	0.104	0.081	8.899E-7	1374	0.078	0.055	7q1yA.pdb.gz
18	PDB:4lnvA	0.086	0.070	1.035E-6	1276	0.067	0.051	4lnvA.pdb.gz
19	PDB:6dldD	0.120	0.300	1.399E-6	269	0.037	0.134	6dldD.pdb.gz
20	PDB:6h03A	0.100	0.082	2.557E-6	1223	0.078	0.061	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A6YW27	562	810	0.317	0.377	A0A0A6YW27_MOUSE Protocadherin gamma subfamily A, 1 OS=Mus musculus OX=10090 GN=Pcdhga1 PE=1 SV=1
2	A0A0A6YXT1	582	813	0.341	0.403	A0A0A6YXT1_MOUSE Protocadherin gamma subfamily A, 7 OS=Mus musculus OX=10090 GN=Pcdhga7 PE=1 SV=1
3	A0A2R8QI99	575	997	0.320	0.309	A0A2R8QI99_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=4 SV=1
4	B9EKB6	649	900	0.391	0.419	B9EKB6_MOUSE Pcdha6 protein OS=Mus musculus OX=10090 GN=Pcdha6 PE=2 SV=1
5	I6LBX6	587	931	0.391	0.405	I6LBX6_RAT Protocadherin gamma a9 OS=Rattus norvegicus OX=10116 GN=Pcdhga9 PE=2 SV=1
6	O88192	737	914	0.468	0.493	O88192_MOUSE Cadherin-related neural recepter 5 (Fragment) OS=Mus musculus OX=10090 GN=Pcdha12 PE=2 SV=1
7	O88194	700	914	0.450	0.474	O88194_MOUSE Cadherin-related neural recepter 7 (Fragment) OS=Mus musculus OX=10090 GN=Pcdha11 PE=2 SV=1
8	O88690	743	946	0.461	0.469	O88690_MOUSE CNR2 OS=Mus musculus OX=10090 GN=Pcdha6 PE=2 SV=1
9	Q3UTF9	575	874	0.327	0.360	Q3UTF9_MOUSE Cadherin domain-containing protein OS=Mus musculus OX=10090 GN=Pcdhgc4 PE=2 SV=1
10	Q5DTQ9	599	933	0.379	0.391	Q5DTQ9_MOUSE MKIAA0327 protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdhga8 PE=2 SV=1
11	Q641K6	650	902	0.396	0.422	Q641K6_MOUSE Pcdha1 protein OS=Mus musculus OX=10090 GN=Pcdha1 PE=2 SV=1
12	Q6DD96	605	935	0.378	0.389	Q6DD96_MOUSE Protocadherin gamma subfamily A, 7 OS=Mus musculus OX=10090 GN=Pcdhga7 PE=1 SV=1
13	Q6NXW8	560	812	0.314	0.372	Q6NXW8_MOUSE Pcdhga12 protein OS=Mus musculus OX=10090 GN=Pcdhga12 PE=2 SV=1
14	Q6NXY6	611	931	0.387	0.401	Q6NXY6_MOUSE Pcdhgb7 protein OS=Mus musculus OX=10090 GN=Pcdhgb7 PE=2 SV=1
15	Q6NYV7	574	1001	0.320	0.308	Q6NYV7_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=2 SV=1
16	Q6P0A6	552	896	0.328	0.353	Q6P0A6_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
17	Q6PHX8	599	932	0.379	0.392	Q6PHX8_MOUSE Protocadherin gamma subfamily A, 8 OS=Mus musculus OX=10090 GN=Pcdhga8 PE=2 SV=1
18	Q7TQF1	572	918	0.361	0.379	Q7TQF1_MOUSE Protocadherin gamma subfamily B, 1 OS=Mus musculus OX=10090 GN=Pcdhgb1 PE=2 SV=1
19	Q805F0	572	1026	0.314	0.294	Q805F0_DANRE Protocadherin 10 OS=Danio rerio OX=7955 GN=pcdh10 PE=2 SV=1
20	Q8BNI7	549	829	0.310	0.361	Q8BNI7_MOUSE Cadherin domain-containing protein OS=Mus musculus OX=10090 GN=Pcdhgb4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	1.9e-64	225.5	Cadherin domain
2	PF08266 Cadherin_2	1e-25	100.7	Cadherin-like
3	PF16184 Cadherin_3	4.1e+02	12.3	Cadherin-like
4	PF16492 Cadherin_C_2	9.7e-06	37.5	Cadherin cytoplasmic C-terminal
5	PF15974 Cadherin_tail	6.9e-65	229.0	Cadherin C-terminal cytoplasmic tail, catenin-binding region
6	PF17665 DUF5527	1.4e+02	13.6	Family of unknown function (DUF5527)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253807

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000466274	0.659	Zinc finger protein 540
2	9606.ENSP00000361345	0.630	Protein FAM78A
3	9606.ENSP00000351345	0.612	ALK and LTK ligand 1
4	9606.ENSP00000321848	0.611	Zinc finger protein 671
5	9606.ENSP00000439287	0.590	Regulating synaptic membrane exocytosis protein 4
6	9606.ENSP00000421258	0.562	Zinc finger protein 154

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046872	0.898	metal ion binding
GO:0005509	0.761	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0032501	0.961	multicellular organismal process
GO:0048856	0.959	anatomical structure development
GO:0007275	0.928	multicellular organism development
GO:0048731	0.889	system development
GO:0007399	0.862	nervous system development
GO:0007155	0.824	cell adhesion
GO:0050789	0.339	regulation of biological process
GO:0050794	0.329	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.985	cell periphery
GO:0005886	0.984	plasma membrane
GO:0043226	0.811	organelle
GO:0043227	0.718	membrane-bounded organelle
GO:0043229	0.537	intracellular organelle
GO:0043231	0.478	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]