StarFunc result for job id Q9H160

User Input

>input (280 residues)
MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETL
KEIDDVYEKYKKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMEL
HSQCFQDPAESERASDKAKMDSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKE
KKSKSAKKKKRSKAKQEREASPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHF
SCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKDRRSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ESK4	0.555	0.553	1.713E-37	281	0.968	0.964	Q9ESK4.pdb.gz	ING2_MOUSE Inhibitor of growth protein 2 OS=Mus musculus OX=10090 GN=Ing2 PE=1 SV=3
2	AFDB:Q9QXV3	0.405	0.407	1.385E-24	279	0.532	0.534	Q9QXV3.pdb.gz	ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus OX=10090 GN=Ing1 PE=2 SV=1
3	AFDB:Q4VBS0	0.352	0.392	1.015E-16	250	0.286	0.320	Q4VBS0.pdb.gz	Q4VBS0_DANRE Inhibitor of growth protein OS=Danio rerio OX=7955 GN=wu:fb11d09 PE=2 SV=1
4	AFDB:Q8C0D7	0.346	0.387	1.642E-16	249	0.307	0.345	Q8C0D7.pdb.gz	ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus OX=10090 GN=Ing4 PE=1 SV=2
5	AFDB:Q8WYH8	0.342	0.397	5.469E-16	240	0.314	0.367	Q8WYH8.pdb.gz	ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens OX=9606 GN=ING5 PE=1 SV=1
6	AFDB:Q9VJY8	0.356	0.350	7.388E-16	285	0.304	0.298	Q9VJY8.pdb.gz	ING5_DROME Inhibitor of growth protein 5 OS=Drosophila melanogaster OX=7227 GN=Ing5 PE=1 SV=2
7	AFDB:Q9VEF5	0.400	0.262	3.271E-14	433	0.379	0.245	Q9VEF5.pdb.gz	Q9VEF5_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7379 PE=1 SV=1
8	AFDB:Q54PN9	0.348	0.302	6.733E-14	324	0.286	0.247	Q54PN9.pdb.gz	ING1_DICDI Inhibitor of growth protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=dng1 PE=1 SV=1
9	AFDB:Q9LIQ6	0.339	0.401	2.343E-12	234	0.232	0.278	Q9LIQ6.pdb.gz	ING1_ARATH PHD finger protein ING1 OS=Arabidopsis thaliana OX=3702 GN=ING1 PE=1 SV=1
10	AFDB:P38806	0.250	0.248	6.411E-11	282	0.250	0.248	P38806.pdb.gz	YNG2_YEAST Chromatin modification-related protein YNG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNG2 PE=1 SV=1
11	PDB:7vvuV	0.262	0.519	1.660E-2	113	0.075	0.186	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
12	PDB:5nugA	0.316	0.034	1.363E-1	2920	0.068	0.007	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
13	PDB:2b5uA	0.336	0.212	1.956E-1	470	0.079	0.047	2b5uA.pdb.gz
14	PDB:1kmiZ	0.164	0.238	5.121E-1	177	0.068	0.107	1kmiZ.pdb.gz	Structure and catalytic mechanism of the E. coli chemotaxis phosphatase CheZ.
15	PDB:7n6g3I	0.272	0.200	5.776E-1	401	0.046	0.032	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
16	PDB:2zdiB	0.274	0.685	6.134E-1	106	0.036	0.094	2zdiB.pdb.gz
17	PDB:3hajA	0.254	0.249	6.918E-1	286	0.050	0.049	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
18	PDB:6tuyA	0.286	0.128	6.918E-1	667	0.043	0.018	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
19	PDB:6z6oC	0.273	0.160	6.918E-1	548	0.043	0.022	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
20	PDB:4n78F	0.202	0.320	7.803E-1	156	0.079	0.141	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ESK4	0.0	557	281	0.968	0.964	ING2_MOUSE Inhibitor of growth protein 2 OS=Mus musculus OX=10090 GN=Ing2 PE=1 SV=3
2	Q9H160	0.0	577	280	1.000	1.000	ING2_HUMAN Inhibitor of growth protein 2 OS=Homo sapiens OX=9606 GN=ING2 PE=1 SV=2
3	Q9QXV3	1.49e-103	305	279	0.589	0.591	ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus OX=10090 GN=Ing1 PE=2 SV=1
4	C9J4X5	1.62e-81	243	138	0.429	0.870	C9J4X5_HUMAN Inhibitor of growth family member 2 (Fragment) OS=Homo sapiens OX=9606 GN=ING2 PE=1 SV=1
5	Q9UK53	1.49e-79	248	422	0.489	0.325	ING1_HUMAN Inhibitor of growth protein 1 OS=Homo sapiens OX=9606 GN=ING1 PE=1 SV=2
6	Q9D8Y8	1.78e-49	165	240	0.321	0.375	ING5_MOUSE Inhibitor of growth protein 5 OS=Mus musculus OX=10090 GN=Ing5 PE=1 SV=1
7	Q4VBS0	4.92e-49	164	250	0.325	0.364	Q4VBS0_DANRE Inhibitor of growth protein OS=Danio rerio OX=7955 GN=wu:fb11d09 PE=2 SV=1
8	Q8WYH8	3.25e-46	157	240	0.314	0.367	ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens OX=9606 GN=ING5 PE=1 SV=1
9	Q9UNL4	1.00e-44	153	249	0.321	0.361	ING4_HUMAN Inhibitor of growth protein 4 OS=Homo sapiens OX=9606 GN=ING4 PE=1 SV=1
10	Q8C0D7	1.02e-44	153	249	0.321	0.361	ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus OX=10090 GN=Ing4 PE=1 SV=2
11	Q9VJY8	1.74e-43	151	285	0.318	0.312	ING5_DROME Inhibitor of growth protein 5 OS=Drosophila melanogaster OX=7227 GN=Ing5 PE=1 SV=2
12	Q9VEF5	1.53e-31	123	433	0.168	0.109	Q9VEF5_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7379 PE=1 SV=1
13	Q9LIQ6	1.47e-30	116	234	0.261	0.312	ING1_ARATH PHD finger protein ING1 OS=Arabidopsis thaliana OX=3702 GN=ING1 PE=1 SV=1
14	E7ET07	3.87e-29	116	403	0.150	0.104	E7ET07_HUMAN Inhibitor of growth protein OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=1
15	Q9NXR8	5.86e-29	115	418	0.150	0.100	ING3_HUMAN Inhibitor of growth protein 3 OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=2
16	Q54PN9	1.61e-27	110	324	0.150	0.130	ING1_DICDI Inhibitor of growth protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=dng1 PE=1 SV=1
17	Q9VWS0	1.29e-25	108	686	0.136	0.055	Q9VWS0_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Ing3 PE=1 SV=1
18	B3H615	5.00e-24	99.8	262	0.257	0.275	ING2_ARATH PHD finger protein ING2 OS=Arabidopsis thaliana OX=3702 GN=ING2 PE=1 SV=1
19	P50947	3.23e-19	87.8	330	0.111	0.094	PHO23_YEAST Transcriptional regulatory protein PHO23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO23 PE=1 SV=1
20	A0A1D8PIP3	6.17e-19	88.2	481	0.111	0.064	A0A1D8PIP3_CANAL Chromatin modification-related protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHO23 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08771 FRB_dom	7.9e+02	11.8	FKBP12-rapamycin binding domain
2	PF12998 ING	5.4e-22	89.6	Inhibitor of growth proteins N-terminal histone-binding
3	PF00628 PHD	0.0095	27.1	PHD-finger
4	PF13831 PHD_2	98	13.8	PHD-finger
5	PF05843 Suf	8e+02	11.4	Suppressor of forked protein (Suf)
6	PF13771 zf-HC5HC2H	77	15.0	PHD-like zinc-binding domain
7	PF08746 zf-RING-like	63	15.2	RING-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010376217.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010380194.1	0.993	SIN3 transcription regulator family member A
2	61622.XP_010355152.1	0.971	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
3	61622.XP_010352359.1	0.970	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
4	61622.XP_010380663.1	0.970	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
5	61622.XP_010362317.1	0.953	Sin3A associated protein 30
6	61622.XP_010376624.1	0.935	PHD finger protein 12
7	61622.XP_010366570.1	0.933	Sin3 histone deacetylase corepressor complex component SDS3
8	61622.XP_010382951.1	0.932	AT-rich interactive domain-containing protein 4B isoform X1
9	61622.XP_010355993.1	0.930	AT-rich interactive domain-containing protein 4A isoform X1
10	61622.XP_010350997.1	0.924	MYST/Esa1 associated factor 6
11	61622.XP_010363627.1	0.916	Breast cancer metastasis-suppressor 1-like protein
12	61622.XP_010384518.1	0.914	Protein FAM60A
13	61622.XP_010370213.1	0.911	DNA methyltransferase 1-associated protein 1 isoform X1
14	61622.XP_010355593.1	0.907	Nuclear transcription factor Y subunit beta
15	61622.XP_010363587.1	0.902	MRG/MORF4L-binding protein
16	61622.XP_010365659.1	0.894	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
17	61622.XP_010377953.1	0.894	Mortality factor 4 like 1
18	61622.XP_010352534.1	0.888	Nuclear transcription factor Y subunit gamma
19	61622.XP_010359776.1	0.873	SIN3 transcription regulator family member B
20	61622.XP_010359998.1	0.873	Paired amphipathic helix protein Sin3b-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	0.999	methylated histone binding
GO:0003676	0.996	nucleic acid binding
GO:0003824	0.870	catalytic activity
GO:0003682	0.841	chromatin binding
GO:0140096	0.838	catalytic activity, acting on a protein
GO:0016740	0.815	transferase activity
GO:0008289	0.812	lipid binding
GO:0005543	0.786	phospholipid binding
GO:0003677	0.786	DNA binding
GO:0035091	0.780	phosphatidylinositol binding
GO:0004402	0.446	histone acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.990	regulation of primary metabolic process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0048522	0.986	positive regulation of cellular process
GO:0009987	0.983	cellular process
GO:0048523	0.980	negative regulation of cellular process
GO:0051252	0.978	regulation of RNA metabolic process
GO:0010556	0.977	regulation of macromolecule biosynthetic process
GO:0009893	0.969	positive regulation of metabolic process
GO:0051173	0.962	positive regulation of nitrogen compound metabolic process
GO:0010604	0.960	positive regulation of macromolecule metabolic process
GO:0006355	0.948	regulation of DNA-templated transcription
GO:0010941	0.945	regulation of cell death
GO:0031325	0.934	positive regulation of cellular metabolic process
GO:0048583	0.915	regulation of response to stimulus
GO:0045935	0.915	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.891	positive regulation of DNA-templated transcription
GO:2001233	0.832	regulation of apoptotic signaling pathway
GO:0009968	0.789	negative regulation of signal transduction
GO:2001234	0.695	negative regulation of apoptotic signaling pathway
GO:0050896	0.503	response to stimulus
GO:0071840	0.486	cellular component organization or biogenesis
GO:0016043	0.440	cellular component organization
GO:0071704	0.403	organic substance metabolic process
GO:0044238	0.366	primary metabolic process
GO:0006807	0.357	nitrogen compound metabolic process
GO:0043170	0.333	macromolecule metabolic process
GO:0009892	0.320	negative regulation of metabolic process
GO:0051246	0.320	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043228	0.996	non-membrane-bounded organelle
GO:0016020	0.989	membrane
GO:0032991	0.988	protein-containing complex
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0140513	0.927	nuclear protein-containing complex
GO:0005886	0.918	plasma membrane
GO:0005694	0.914	chromosome
GO:1902494	0.905	catalytic complex
GO:0000785	0.881	chromatin
GO:0005737	0.657	cytoplasm
GO:0000118	0.605	histone deacetylase complex
GO:0005667	0.552	transcription regulator complex
GO:0000228	0.492	nuclear chromosome
GO:0090575	0.441	RNA polymerase II transcription regulator complex
GO:0070822	0.411	Sin3-type complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.815	Transferases.
RHEA:21992	0.446	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.446	histone acetyltransferase.

[back to server]