StarFunc result for job id Q9H165

User Input

>input (835 residues)
MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDI
LIFIEHKRKQCNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGI
CPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFT
SAWFLLQHAQNTHGLRIYLESEHGSPLTPRVGIPSGLGAECPSQPPLHGIHIADNNPFNL
LRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIERLGAEEMALATHHPSAFDRV
LRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGSKPPFLATPPL
PPLQSAPPPSQPPVKSKSCEFCGKTFKFQSNLVVHRRSHTGEKPYKCNLCDHACTQASKL
KRHMKTHMHKSSPMTVKSDDGLSTASSPEPGTSDLVGSASSALKSVVAKFKSENDPNLIP
ENGDEEEEEDDEEEEEEEEEEEEELTESERVDYGFGLSLEAARHHENSSRGAVVGVGDES
RALPDVMQGMVLSSMQHFSEAFHQVLGEKHKRGHLAEAEGHRDTCDEDSVAGESDRIDDG
TVNGRGCSPGESASGGLSKKLLLGSPSSLSPFSKRIKLEKEFDLPPAAMPNTENVYSQWL
AGYAASRQLKDPFLSFGDSRQSPFASSSEHSSENGSLRFSTPPGELDGGISGRSGTGSGG
STPHISGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACA
QSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D9YZW0	0.219	0.219	0.000	835	1.000	1.000	D9YZW0.pdb.gz	D9YZW0_HUMAN B-cell CLL/lymphoma 11A (Zinc finger protein), isoform CRA_b OS=Homo sapiens OX=9606 GN=BCL11A PE=4 SV=1
2	AFDB:Q1RLR5	0.176	0.177	1.581E-89	829	0.781	0.786	Q1RLR5.pdb.gz	Q1RLR5_DANRE B-cell CLL/lymphoma 11A OS=Danio rerio OX=7955 GN=bcl11a PE=2 SV=1
3	AFDB:A8JV11	0.093	0.069	2.762E-24	1213	0.315	0.217	A8JV11.pdb.gz	A8JV11_DROME Uncharacterized protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Cph PE=4 SV=3
4	AFDB:Q17R98	0.100	0.082	2.047E-12	1081	0.216	0.167	Q17R98.pdb.gz	ZN827_HUMAN Zinc finger protein 827 OS=Homo sapiens OX=9606 GN=ZNF827 PE=1 SV=1
5	AFDB:Q9VY72	0.078	0.047	1.930E-9	1553	0.160	0.086	Q9VY72.pdb.gz	Q9VY72_DROME Maternal gene required for meiosis, isoform H OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=4
6	AFDB:Q7Z4V0	0.073	0.073	1.060E-7	828	0.141	0.143	Q7Z4V0.pdb.gz	ZN438_HUMAN Zinc finger protein 438 OS=Homo sapiens OX=9606 GN=ZNF438 PE=1 SV=1
7	AFDB:F1Q833	0.079	0.077	1.373E-7	908	0.152	0.140	F1Q833.pdb.gz
8	AFDB:Q9VCB2	0.083	0.072	9.539E-7	968	0.154	0.133	Q9VCB2.pdb.gz	Q9VCB2_DROME LD04007p OS=Drosophila melanogaster OX=7227 GN=Spps PE=2 SV=1
9	AFDB:Q13029	0.064	0.035	1.942E-6	1718	0.189	0.092	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
10	AFDB:B9WEF9	0.074	0.085	8.582E-6	708	0.153	0.181	B9WEF9.pdb.gz	B9WEF9_CANDC Transcriptional regulator, putative OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) OX=573826 GN=CRZ1 PE=4 SV=1
11	PDB:3w5kB	0.056	0.278	1.397E-3	110	0.031	0.236	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.032	0.218	9.535E-1	62	0.018	0.242	6ydhA.pdb.gz
13	PDB:4wa6D	0.040	0.063	1.317	415	0.013	0.027	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
14	PDB:7uhyC	0.035	0.044	4.214	578	0.017	0.024	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:7pfoB	0.026	0.028	4.796	759	0.008	0.009	7pfoB.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
16	PDB:5v3hA	0.036	0.062	5.116	438	0.014	0.027	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
17	PDB:6htsR	0.030	0.289	5.457	72	0.017	0.194	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
18	PDB:5xncB	0.035	0.050	6.210	354	0.014	0.034	5xncB.pdb.gz	Active site geometry of a novel aminopropyltransferase for biosynthesis of hyperthermophile-specific branched-chain polyamine.
19	PDB:1zl9A	0.035	0.119	7.538	207	0.006	0.024	1zl9A.pdb.gz	Crystal structure of a major nematode C.elegans specific GST (CE01613)
20	PDB:6g90U	0.035	0.113	7.538	196	0.016	0.066	6g90U.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2U3TZJ5	0.0	1529	793	0.910	0.958	A0A2U3TZJ5_HUMAN BAF chromatin remodeling complex subunit BCL11A OS=Homo sapiens OX=9606 GN=BCL11A PE=1 SV=1
2	A0A8I6ATN1	0.0	1660	829	0.970	0.977	A0A8I6ATN1_RAT BAF chromatin remodeling complex subunit BCL11A OS=Rattus norvegicus OX=10116 GN=Bcl11a PE=4 SV=1
3	A0A8I6AXE0	0.0	1695	835	0.993	0.993	A0A8I6AXE0_RAT BAF chromatin remodeling complex subunit BCL11A OS=Rattus norvegicus OX=10116 GN=Bcl11a PE=4 SV=1
4	A2BE84	0.0	917	776	0.634	0.682	A2BE84_DANRE BAF chromatin-remodeling complex subunit BCL11A b OS=Danio rerio OX=7955 GN=si:ch211-127m10.2 PE=4 SV=1
5	D3ZSY3	0.0	1497	773	0.884	0.955	D3ZSY3_RAT BAF chromatin remodeling complex subunit BCL11A OS=Rattus norvegicus OX=10116 GN=Bcl11a PE=1 SV=2
6	D9YZV9	0.0	1509	773	0.891	0.962	D9YZV9_HUMAN B-cell CLL/lymphoma 11A (Zinc finger protein) isoform 2 OS=Homo sapiens OX=9606 GN=BCL11A PE=4 SV=1
7	D9YZW0	0.0	1709	835	1.000	1.000	D9YZW0_HUMAN B-cell CLL/lymphoma 11A (Zinc finger protein), isoform CRA_b OS=Homo sapiens OX=9606 GN=BCL11A PE=4 SV=1
8	Q1RLR5	0.0	1140	829	0.782	0.788	Q1RLR5_DANRE B-cell CLL/lymphoma 11A OS=Danio rerio OX=7955 GN=bcl11a PE=2 SV=1
9	Q99PV8	0.0	873	884	0.635	0.600	BC11B_MOUSE B-cell lymphoma/leukemia 11B OS=Mus musculus OX=10090 GN=Bcl11b PE=1 SV=1
10	Q9C0K0	0.0	867	894	0.635	0.593	BC11B_HUMAN B-cell lymphoma/leukemia 11B OS=Homo sapiens OX=9606 GN=BCL11B PE=1 SV=1
11	Q9H165	0.0	1709	835	1.000	1.000	BC11A_HUMAN B-cell lymphoma/leukemia 11A OS=Homo sapiens OX=9606 GN=BCL11A PE=1 SV=2
12	Q9QYE3	0.0	1504	773	0.886	0.957	BC11A_MOUSE B-cell lymphoma/leukemia 11A OS=Mus musculus OX=10090 GN=Bcl11a PE=1 SV=1
13	Q5RJJ9	6.82e-149	439	243	0.251	0.864	Q5RJJ9_RAT Bcl11a protein OS=Rattus norvegicus OX=10116 GN=Bcl11a PE=2 SV=1
14	A0A0G2K4M7	2.88e-114	348	209	0.210	0.837	A0A0G2K4M7_RAT BAF chromatin remodeling complex subunit BCL11A OS=Rattus norvegicus OX=10116 GN=Bcl11a PE=1 SV=2
15	A0A023GPJ3	1.49e-41	167	1140	0.092	0.068	A0A023GPJ3_DROME Uncharacterized protein, isoform J OS=Drosophila melanogaster OX=7227 GN=Cph PE=4 SV=1
16	R9PY46	1.53e-41	167	1207	0.092	0.064	R9PY46_DROME Uncharacterized protein, isoform I OS=Drosophila melanogaster OX=7227 GN=Cph PE=4 SV=1
17	A0A499JF18	1.60e-41	167	1254	0.092	0.061	A0A499JF18_DROME Uncharacterized protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Cph PE=4 SV=1
18	A8JV11	1.74e-41	167	1213	0.092	0.063	A8JV11_DROME Uncharacterized protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Cph PE=4 SV=3
19	A8JV12	1.91e-41	166	1209	0.092	0.064	A8JV12_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Cph PE=4 SV=2
20	Q8WUU4	5.34e-26	114	475	0.060	0.105	ZN296_HUMAN Zinc finger protein 296 OS=Homo sapiens OX=9606 GN=ZNF296 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12226 Astro_capsid_p	1.6e+02	12.9	Turkey astrovirus capsid protein
2	PF05432 BSP_II	5.3	18.3	Bone sialoprotein II (BSP-II)
3	PF02862 DDHD	2.4e+02	13.2	DDHD domain
4	PF11672 DUF3268	9	18.0	zinc-finger-containing domain
5	PF01363 FYVE	5.2e+02	12.2	FYVE zinc finger
6	PF06524 NOA36	10	17.0	NOA36 protein
7	PF11705 RNA_pol_3_Rpc31	8.8e+02	11.2	DNA-directed RNA polymerase III subunit Rpc31
8	PF19088 TUTase	1.2e+02	13.5	TUTase nucleotidyltransferase domain
9	PF00096 zf-C2H2	1.5e-23	93.0	Zinc finger, C2H2 type
10	PF13894 zf-C2H2_4	3.9e-12	56.9	C2H2-type zinc finger
11	PF13465 zf-H2C2_2	1.4e-12	58.7	Zinc-finger double domain
12	PF13909 zf-H2C2_5	0.0084	27.1	C2H2-type zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010375894.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010352478.1	0.981	RB binding protein 4, chromatin remodeling factor
2	61622.XP_010367558.1	0.909	RB binding protein 7, chromatin remodeling factor
3	61622.XP_010375257.1	0.853	Metastasis associated 1
4	61622.XP_010352359.1	0.813	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
5	61622.XP_010380663.1	0.813	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
6	61622.XP_010359390.1	0.792	GATA binding protein 1
7	61622.XP_010387152.1	0.789	methyl-CpG-binding domain protein 3-like 1
8	61622.XP_010355152.1	0.761	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
9	61622.XP_010378594.1	0.723	PHD finger protein 20-like protein 1 isoform X1
10	61622.XP_010362667.1	0.699	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
11	61622.XP_010372085.1	0.696	Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family.
12	61622.XP_010383197.1	0.679	Metastasis-associated protein MTA2
13	61622.XP_010355408.1	0.651	SRY-box 6
14	61622.XP_010363203.1	0.651	Transcription factor SOX-6-like
15	61622.XP_010383785.1	0.647	Lymphocyte antigen 6 complex, locus H
16	61622.XP_010375659.1	0.644	Exportin-1 isoform X1
17	61622.XP_010369042.1	0.613	HBS1-like protein isoform X1
18	61622.XP_010360584.1	0.612	Alpha hemoglobin stabilizing protein
19	61622.XP_010363095.1	0.612	Nuclear receptor subfamily 2 group E member 3
20	61622.XP_010359627.1	0.604	Nuclear receptor subfamily 2 group F member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.997	enzyme binding
GO:0019901	0.986	protein kinase binding
GO:0003676	0.981	nucleic acid binding
GO:0003677	0.967	DNA binding
GO:0140110	0.922	transcription regulator activity
GO:0043565	0.922	sequence-specific DNA binding
GO:0003690	0.871	double-stranded DNA binding
GO:1990837	0.856	sequence-specific double-stranded DNA binding
GO:0003700	0.827	DNA-binding transcription factor activity
GO:0000981	0.791	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.759	transcription cis-regulatory region binding
GO:0000977	0.750	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.466	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.433	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140297	0.413	DNA-binding transcription factor binding
GO:0001227	0.386	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048519	0.988	negative regulation of biological process
GO:0019222	0.985	regulation of metabolic process
GO:0060255	0.984	regulation of macromolecule metabolic process
GO:0009987	0.978	cellular process
GO:0048523	0.975	negative regulation of cellular process
GO:0048518	0.974	positive regulation of biological process
GO:0010468	0.964	regulation of gene expression
GO:0050793	0.936	regulation of developmental process
GO:0050896	0.920	response to stimulus
GO:0045595	0.898	regulation of cell differentiation
GO:0051239	0.889	regulation of multicellular organismal process
GO:0051171	0.888	regulation of nitrogen compound metabolic process
GO:0080090	0.886	regulation of primary metabolic process
GO:0031323	0.839	regulation of cellular metabolic process
GO:0060284	0.835	regulation of cell development
GO:0045926	0.829	negative regulation of growth
GO:0051093	0.818	negative regulation of developmental process
GO:0019219	0.814	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.803	positive regulation of metabolic process
GO:0009889	0.783	regulation of biosynthetic process
GO:0010604	0.783	positive regulation of macromolecule metabolic process
GO:0031344	0.780	regulation of cell projection organization
GO:1903859	0.780	regulation of dendrite extension
GO:0031326	0.773	regulation of cellular biosynthetic process
GO:0030308	0.758	negative regulation of cell growth
GO:0051252	0.741	regulation of RNA metabolic process
GO:1903429	0.739	regulation of cell maturation
GO:2001141	0.731	regulation of RNA biosynthetic process
GO:0006355	0.721	regulation of DNA-templated transcription
GO:0048522	0.720	positive regulation of cellular process
GO:0120035	0.692	regulation of plasma membrane bounded cell projection organization
GO:0031345	0.688	negative regulation of cell projection organization
GO:0001101	0.677	response to acid chemical
GO:0045596	0.672	negative regulation of cell differentiation
GO:0051716	0.662	cellular response to stimulus
GO:0048640	0.649	negative regulation of developmental growth
GO:0010977	0.648	negative regulation of neuron projection development
GO:0032502	0.622	developmental process
GO:0032501	0.586	multicellular organismal process
GO:0048856	0.568	anatomical structure development
GO:0060688	0.567	regulation of morphogenesis of a branching structure
GO:0050773	0.562	regulation of dendrite development
GO:0010721	0.532	negative regulation of cell development
GO:0010605	0.445	negative regulation of macromolecule metabolic process
GO:0071840	0.439	cellular component organization or biogenesis
GO:0071704	0.438	organic substance metabolic process
GO:0006357	0.437	regulation of transcription by RNA polymerase II
GO:0010033	0.419	response to organic substance
GO:0051172	0.417	negative regulation of nitrogen compound metabolic process
GO:0031325	0.414	positive regulation of cellular metabolic process
GO:0051173	0.411	positive regulation of nitrogen compound metabolic process
GO:0031324	0.397	negative regulation of cellular metabolic process
GO:0031327	0.386	negative regulation of cellular biosynthetic process
GO:0010558	0.385	negative regulation of macromolecule biosynthetic process
GO:0051253	0.385	negative regulation of RNA metabolic process
GO:0045892	0.381	negative regulation of DNA-templated transcription
GO:0007275	0.368	multicellular organism development
GO:0071229	0.365	cellular response to acid chemical
GO:0043200	0.365	response to amino acid
GO:0071230	0.362	cellular response to amino acid stimulus
GO:0045935	0.359	positive regulation of nucleobase-containing compound metabolic process
GO:0045664	0.358	regulation of neuron differentiation
GO:1902075	0.357	cellular response to salt
GO:0044238	0.349	primary metabolic process
GO:0006807	0.347	nitrogen compound metabolic process
GO:0051254	0.344	positive regulation of RNA metabolic process
GO:0016043	0.330	cellular component organization
GO:0010557	0.325	positive regulation of macromolecule biosynthetic process
GO:0031328	0.325	positive regulation of cellular biosynthetic process
GO:1902680	0.314	positive regulation of RNA biosynthetic process
GO:0051241	0.312	negative regulation of multicellular organismal process
GO:0048731	0.304	system development
GO:0043170	0.302	macromolecule metabolic process
GO:0045893	0.302	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.871	protein-containing complex
GO:0005737	0.723	cytoplasm
GO:0043232	0.655	intracellular non-membrane-bounded organelle
GO:0000785	0.515	chromatin
GO:0140513	0.347	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]