StarFunc result for job id Q9H169

User Input

>input (189 residues)
MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTS
GQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKR
EHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKN
KELKEEASR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H169	1.000	1.000	5.182E-27	189	1.000	1.000	Q9H169.pdb.gz	STMN4_HUMAN Stathmin-4 OS=Homo sapiens OX=9606 GN=STMN4 PE=1 SV=1
2	AFDB:Q5RIC7	0.771	0.775	1.352E-20	188	0.804	0.809	Q5RIC7.pdb.gz	Q5RIC7_DANRE Stathmin OS=Danio rerio OX=7955 GN=wu:fj44e06 PE=3 SV=1
3	AFDB:P21818	0.617	0.646	2.517E-14	179	0.603	0.637	P21818.pdb.gz	STMN2_RAT Stathmin-2 OS=Rattus norvegicus OX=10116 GN=Stmn2 PE=1 SV=2
4	AFDB:E7FE68	0.684	0.716	3.772E-14	180	0.571	0.600	E7FE68.pdb.gz	E7FE68_DANRE Stathmin OS=Danio rerio OX=7955 GN=zgc:92905 PE=3 SV=1
5	AFDB:Q4VBT7	0.704	0.736	6.471E-14	180	0.571	0.600	Q4VBT7.pdb.gz	Q4VBT7_DANRE Stathmin OS=Danio rerio OX=7955 GN=scg10 PE=2 SV=1
6	AFDB:O70166	0.546	0.568	1.359E-13	180	0.598	0.628	O70166.pdb.gz	STMN3_MOUSE Stathmin-3 OS=Mus musculus OX=10090 GN=Stmn3 PE=1 SV=1
7	AFDB:P13668	0.581	0.712	1.010E-10	149	0.524	0.664	P13668.pdb.gz	STMN1_RAT Stathmin OS=Rattus norvegicus OX=10116 GN=Stmn1 PE=1 SV=2
8	AFDB:Q5XIY0	0.368	0.394	7.647E-10	175	0.402	0.434	Q5XIY0.pdb.gz
9	AFDB:M9NEA1	0.471	0.245	5.175E-4	381	0.270	0.134	M9NEA1.pdb.gz	M9NEA1_DROME Stathmin, isoform D OS=Drosophila melanogaster OX=7227 GN=stai PE=1 SV=1
10	AFDB:Q8IPK0	0.502	0.321	2.990E-3	302	0.270	0.169	Q8IPK0.pdb.gz	Q8IPK0_DROME Stathmin, isoform B OS=Drosophila melanogaster OX=7227 GN=stai PE=1 SV=1
11	PDB:7qdsA	0.074	0.084	2.118	155	0.079	0.097	7qdsA.pdb.gz
12	PDB:6edtJ	0.117	0.173	2.266	109	0.063	0.110	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
13	PDB:6hndB	0.093	0.041	3.397	470	0.053	0.021	6hndB.pdb.gz	Crystal structures of aminotransferases Aro8 and Aro9 from Candida albicans and structural insights into their properties.
14	PDB:6faiG	0.226	0.190	4.158	232	0.069	0.056	6faiG.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
15	PDB:7egbA	0.081	0.034	4.449	558	0.032	0.011	7egbA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
16	PDB:7odrO	0.112	0.135	4.449	154	0.063	0.078	7odrO.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
17	PDB:2oghA	0.113	0.176	4.759	108	0.048	0.083	2oghA.pdb.gz
18	PDB:2jkfA	0.081	0.089	5.447	170	0.016	0.018	2jkfA.pdb.gz
19	PDB:5e38B	0.077	0.083	6.233	175	0.011	0.011	5e38B.pdb.gz
20	PDB:2zdiC	0.095	0.117	6.668	148	0.016	0.020	2zdiC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H169	2.89e-136	380	189	1.000	1.000	STMN4_HUMAN Stathmin-4 OS=Homo sapiens OX=9606 GN=STMN4 PE=1 SV=1
2	Q5RIC7	1.73e-103	297	188	0.804	0.809	Q5RIC7_DANRE Stathmin OS=Danio rerio OX=7955 GN=wu:fj44e06 PE=3 SV=1
3	Q6PBU3	1.89e-103	297	188	0.804	0.809	Q6PBU3_DANRE Stathmin OS=Danio rerio OX=7955 GN=zgc:73243 PE=2 SV=1
4	P55821	1.84e-69	211	179	0.630	0.665	STMN2_MOUSE Stathmin-2 OS=Mus musculus OX=10090 GN=Stmn2 PE=1 SV=1
5	Q93045	1.84e-69	211	179	0.630	0.665	STMN2_HUMAN Stathmin-2 OS=Homo sapiens OX=9606 GN=STMN2 PE=1 SV=3
6	P21818	1.29e-68	208	179	0.624	0.659	STMN2_RAT Stathmin-2 OS=Rattus norvegicus OX=10116 GN=Stmn2 PE=1 SV=2
7	O70166	1.35e-65	201	180	0.603	0.633	STMN3_MOUSE Stathmin-3 OS=Mus musculus OX=10090 GN=Stmn3 PE=1 SV=1
8	Q9JHU6	5.23e-65	199	180	0.603	0.633	STMN3_RAT Stathmin-3 OS=Rattus norvegicus OX=10116 GN=Stmn3 PE=1 SV=1
9	Q9NZ72	7.25e-65	199	180	0.598	0.628	STMN3_HUMAN Stathmin-3 OS=Homo sapiens OX=9606 GN=STMN3 PE=1 SV=3
10	E7FE68	1.72e-63	196	180	0.577	0.606	E7FE68_DANRE Stathmin OS=Danio rerio OX=7955 GN=zgc:92905 PE=3 SV=1
11	Q4VBT7	2.82e-62	192	180	0.577	0.606	Q4VBT7_DANRE Stathmin OS=Danio rerio OX=7955 GN=scg10 PE=2 SV=1
12	A0A0J9YW36	7.59e-62	193	239	0.593	0.469	A0A0J9YW36_HUMAN Stathmin 3 (Fragment) OS=Homo sapiens OX=9606 GN=STMN3 PE=1 SV=1
13	P13668	1.55e-60	187	149	0.534	0.678	STMN1_RAT Stathmin OS=Rattus norvegicus OX=10116 GN=Stmn1 PE=1 SV=2
14	P16949	2.57e-60	186	149	0.534	0.678	STMN1_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3
15	Q96CE4	3.85e-60	186	149	0.534	0.678	Q96CE4_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=1
16	P54227	4.25e-60	186	149	0.529	0.671	STMN1_MOUSE Stathmin OS=Mus musculus OX=10090 GN=Stmn1 PE=1 SV=2
17	P31395	2.21e-59	184	148	0.524	0.669	STMN1_CHICK Stathmin OS=Gallus gallus OX=9031 GN=STMN1 PE=1 SV=1
18	Q9GQR4	3.05e-12	63.9	174	0.286	0.310	Q9GQR4_DROME Stathmin (Fragment) OS=Drosophila melanogaster OX=7227 GN=stai PE=2 SV=1
19	Q9GQR6	1.16e-11	63.5	234	0.286	0.231	Q9GQR6_DROME Stathmin-1 OS=Drosophila melanogaster OX=7227 GN=stai PE=2 SV=1
20	Q9VMH3	1.41e-11	63.5	250	0.270	0.204	Q9VMH3_DROME LD04103p OS=Drosophila melanogaster OX=7227 GN=stai PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04614 Pex19	22	16.3	Pex19 protein family
2	PF00836 Stathmin	8.6e-52	186.1	Stathmin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 59463.ENSMLUP00000004034

Rank	PPI partner	STRING score	Description
1	59463.ENSMLUP00000010602	0.899	Uncharacterized protein
2	59463.ENSMLUP00000021395	0.899	annotation not available
3	59463.ENSMLUP00000005741	0.892	Tubulin beta chain
4	59463.ENSMLUP00000006204	0.881	Tubulin beta chain
5	59463.ENSMLUP00000014739	0.881	Tubulin beta chain
6	59463.ENSMLUP00000014211	0.868	Tubulin beta chain
7	59463.ENSMLUP00000018494	0.850	Uncharacterized protein
8	59463.ENSMLUP00000021740	0.850	Uncharacterized protein
9	59463.ENSMLUP00000007373	0.833	Tubulin alpha chain
10	59463.ENSMLUP00000002864	0.822	Cyclin-dependent kinase inhibitor 1B (p27, Kip1)
11	59463.ENSMLUP00000002379	0.818	Tubulin alpha chain
12	59463.ENSMLUP00000009888	0.818	Tubulin alpha chain
13	59463.ENSMLUP00000013653	0.818	Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
14	59463.ENSMLUP00000014144	0.818	Tubulin alpha chain
15	59463.ENSMLUP00000017109	0.818	Tubulin alpha chain
16	59463.ENSMLUP00000017338	0.818	Tubulin alpha chain
17	59463.ENSMLUP00000017356	0.818	Uncharacterized protein
18	59463.ENSMLUP00000018853	0.818	Uncharacterized protein
19	59463.ENSMLUP00000019062	0.818	Tubulin alpha chain
20	59463.ENSMLUP00000022270	0.818	Tubulin alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0010564	0.887	regulation of cell cycle process
GO:0048523	0.787	negative regulation of cellular process
GO:0010639	0.622	negative regulation of organelle organization
GO:0048856	0.487	anatomical structure development
GO:0032501	0.473	multicellular organismal process
GO:0009987	0.416	cellular process
GO:1902903	0.413	regulation of supramolecular fiber organization
GO:0048518	0.381	positive regulation of biological process
GO:0048522	0.357	positive regulation of cellular process
GO:0050793	0.301	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.999	membrane-bounded organelle
GO:0012505	0.980	endomembrane system
GO:0043231	0.974	intracellular membrane-bounded organelle
GO:0005829	0.901	cytosol
GO:0005794	0.426	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]