StarFunc result for job id Q9H171

User Input

>input (429 residues)
MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSL
TSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDN
GPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASII
YQHNPINMICQNGPNSWISIANSEAIQIGHGNIITRQTVSREDGSAGPRHLPSMAPGDSS
TWGTLVDPWGPQDIHMEQSILRRVQLGHSNEMRLHGVPSEGPAHIPPGSPPVSATAAGPE
ASFEARIPSPGTHPEGEAAQRIHMKSCFLEDATIGNSNKMSISPGVAGPGGVAGSGEGEP
GEDAGRRPADTQSRSHFPRDIGQPITPSHSKLTPKLETMTLGNRSHKAAEGSHYVDEASH
EGSWWGGGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2RRL9	0.408	0.408	6.244E-63	429	0.995	0.995	A2RRL9.pdb.gz	A2RRL9_HUMAN Z-DNA binding protein 1 OS=Homo sapiens OX=9606 GN=ZBP1 PE=1 SV=1
2	AFDB:A2APF7	0.203	0.210	1.537E-26	411	0.462	0.482	A2APF7.pdb.gz	A2APF7_MOUSE Z-DNA binding protein 1 OS=Mus musculus OX=10090 GN=Zbp1 PE=1 SV=1
3	AFDB:F1MUM9	0.146	0.059	2.755E-7	1149	0.135	0.050	F1MUM9.pdb.gz	F1MUM9_BOVIN Adenosine deaminase RNA specific OS=Bos taurus OX=9913 GN=ADAR PE=1 SV=3
4	AFDB:Q99MU3	0.144	0.059	5.352E-7	1178	0.133	0.048	Q99MU3.pdb.gz	DSRAD_MOUSE Double-stranded RNA-specific adenosine deaminase OS=Mus musculus OX=10090 GN=Adar PE=1 SV=2
5	AFDB:P55265	0.143	0.051	6.318E-7	1226	0.142	0.050	P55265.pdb.gz	DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4
6	PDB:3cuqA	0.149	0.265	7.266E-3	219	0.049	0.096	3cuqA.pdb.gz
7	PDB:5f8cB	0.115	0.136	3.238E-2	363	0.030	0.036	5f8cB.pdb.gz
8	PDB:8d0bB	0.140	0.163	4.513E-2	362	0.037	0.044	8d0bB.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
9	PDB:1x19A	0.122	0.147	5.632E-2	350	0.028	0.034	1x19A.pdb.gz
10	PDB:4a6dA	0.134	0.164	7.427E-2	345	0.056	0.070	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
11	PDB:1c0wB	0.124	0.232	7.850E-2	219	0.023	0.046	1c0wB.pdb.gz	Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
12	PDB:5lzbz	0.206	0.152	7.850E-2	614	0.042	0.029	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
13	PDB:1c0wD	0.124	0.284	8.297E-2	175	0.023	0.057	1c0wD.pdb.gz	Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
14	PDB:1r1uC	0.127	0.512	9.795E-2	98	0.028	0.122	1r1uC.pdb.gz
15	PDB:4ev0D	0.125	0.240	9.795E-2	214	0.026	0.051	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
16	AFDB:P51974	0.112	0.107	9.829E-2	457	0.142	0.133	P51974.pdb.gz	PAX8_RAT Paired box protein Pax-8 OS=Rattus norvegicus OX=10116 GN=Pax8 PE=1 SV=2
17	AFDB:Q5RIX9	0.126	0.087	1.039E-1	723	0.163	0.097	Q5RIX9.pdb.gz	E2F7_DANRE Transcription factor E2F7 OS=Danio rerio OX=7955 GN=e2f7 PE=1 SV=2
18	AFDB:W0S3W1	0.115	0.109	2.133E-1	458	0.135	0.127	W0S3W1.pdb.gz	W0S3W1_ONCMY Transcription factor Pax8a OS=Oncorhynchus mykiss OX=8022 GN=Pax8a PE=2 SV=1
19	AFDB:Q90267	0.098	0.119	3.142E-1	338	0.147	0.186	Q90267.pdb.gz	OTX1A_DANRE Homeobox protein OTX1 A OS=Danio rerio OX=7955 GN=otx1a PE=2 SV=1
20	AFDB:Q9DBY0	0.101	0.059	3.321E-1	795	0.159	0.086	Q9DBY0.pdb.gz	FOXP4_MOUSE Forkhead box protein P4 OS=Mus musculus OX=10090 GN=Foxp4 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RRL9	0.0	875	429	0.995	0.995	A2RRL9_HUMAN Z-DNA binding protein 1 OS=Homo sapiens OX=9606 GN=ZBP1 PE=1 SV=1
2	Q9H171	0.0	878	429	1.000	1.000	ZBP1_HUMAN Z-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=ZBP1 PE=1 SV=2
3	A2APF7	6.40e-100	306	411	0.459	0.479	A2APF7_MOUSE Z-DNA binding protein 1 OS=Mus musculus OX=10090 GN=Zbp1 PE=1 SV=1
4	Q9QY24	1.44e-99	305	411	0.459	0.479	ZBP1_MOUSE Z-DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Zbp1 PE=1 SV=1
5	F1MUM9	0.014	40.4	1149	0.105	0.039	F1MUM9_BOVIN Adenosine deaminase RNA specific OS=Bos taurus OX=9913 GN=ADAR PE=1 SV=3
6	P55266	0.049	38.5	1175	0.154	0.056	DSRAD_RAT Double-stranded RNA-specific adenosine deaminase OS=Rattus norvegicus OX=10116 GN=Adar PE=1 SV=1
7	Q0H740	0.12	37.0	513	0.054	0.045	Q0H740_SALSA DsRNA activated Z-DNA binding protein kinase OS=Salmo salar OX=8030 GN=PKZ PE=2 SV=1
8	Q99MU3	1.1	34.3	1178	0.098	0.036	DSRAD_MOUSE Double-stranded RNA-specific adenosine deaminase OS=Mus musculus OX=10090 GN=Adar PE=1 SV=2
9	P39109	1.4	33.9	1515	0.068	0.019	YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCF1 PE=1 SV=2
10	Q8IPH7	4.6	32.3	1034	0.047	0.019	Q8IPH7_DROME Myosin 28B1, isoform C OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=3 SV=2
11	Q7YU72	4.7	32.3	1035	0.047	0.019	Q7YU72_DROME RH39293p OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=1
12	Q8IPH6	4.7	32.3	1033	0.047	0.019	Q8IPH6_DROME FI20293p1 OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=2
13	P31428	5.1	32.0	410	0.030	0.032	DPEP1_MOUSE Dipeptidase 1 OS=Mus musculus OX=10090 GN=Dpep1 PE=1 SV=2
14	Q80VI1	7.0	31.6	734	0.061	0.035	TRI56_MOUSE E3 ubiquitin-protein ligase TRIM56 OS=Mus musculus OX=10090 GN=Trim56 PE=1 SV=1
15	Q5B4F5	7.4	31.2	357	0.049	0.059	Q5B4F5_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04575 PE=4 SV=1
16	Q4GYH2	8.2	31.2	925	0.030	0.014	Q4GYH2_TRYB2 Serine/threonine-protein phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4050 PE=3 SV=1
17	A0A3B3IRQ9	8.7	31.2	1158	0.042	0.016	A0A3B3IRQ9_HUMAN Double-stranded RNA-specific adenosine deaminase (Fragment) OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=1
18	P55265	9.1	31.2	1226	0.042	0.015	DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4
19	P04775	9.9	31.2	2005	0.035	0.007	SCN2A_RAT Sodium channel protein type 2 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn2a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17782 DprA_WH	35	15.9	DprA winged helix domain
2	PF16657 Malt_amylase_C	3.2e+02	12.8	Maltogenic Amylase, C-terminal domain
3	PF12721 RHIM	3.4	18.5	RIP homotypic interaction motif
4	PF02295 z-alpha	4e-10	50.9	Adenosine deaminase z-alpha domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360215

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216274	0.991	Receptor-interacting serine/threonine-protein kinase 3
2	9606.ENSP00000259808	0.981	Receptor-interacting serine/threonine-protein kinase 1
3	9606.ENSP00000380697	0.949	Interferon regulatory factor 7
4	9606.ENSP00000471896	0.948	Interferon regulatory factor 3
5	9606.ENSP00000329967	0.942	Serine/threonine-protein kinase TBK1
6	9606.ENSP00000359424	0.929	Inhibitor of nuclear factor kappa-B kinase subunit alpha
7	9606.ENSP00000430684	0.922	Inhibitor of nuclear factor kappa-B kinase subunit beta
8	9606.ENSP00000483825	0.920	NF-kappa-B essential modulator
9	9606.ENSP00000272317	0.902	Ubiquitin-40S ribosomal protein S27a
10	9606.ENSP00000304697	0.902	Polyubiquitin-B
11	9606.ENSP00000441543	0.902	Polyubiquitin-C
12	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
13	9606.ENSP00000464030	0.896	Inhibitor of nuclear factor kappa-B kinase subunit epsilon
14	9606.ENSP00000259030	0.807	Receptor-transporting protein 4
15	9606.ENSP00000333266	0.755	Ubiquitin-like modifier-activating enzyme 7
16	9606.ENSP00000216797	0.691	NF-kappa-B inhibitor alpha
17	9606.ENSP00000357112	0.677	Interferon-inducible protein AIM2
18	9606.ENSP00000359787	0.673	Interferon-induced protein 44-like
19	9606.ENSP00000369213	0.667	Probable ATP-dependent RNA helicase DDX58
20	9606.ENSP00000395590	0.663	Interferon-induced 35 kDa protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.844	nucleic acid binding
GO:0003677	0.726	DNA binding
GO:0042802	0.613	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010942	0.997	positive regulation of cell death
GO:0051707	0.995	response to other organism
GO:0051607	0.985	defense response to virus
GO:0043067	0.975	regulation of programmed cell death
GO:0010939	0.975	regulation of necrotic cell death
GO:0043068	0.953	positive regulation of programmed cell death
GO:0009987	0.767	cellular process
GO:0048583	0.738	regulation of response to stimulus
GO:0019222	0.700	regulation of metabolic process
GO:0060255	0.687	regulation of macromolecule metabolic process
GO:0010468	0.623	regulation of gene expression
GO:0048584	0.582	positive regulation of response to stimulus
GO:0080090	0.573	regulation of primary metabolic process
GO:0051171	0.552	regulation of nitrogen compound metabolic process
GO:0009893	0.514	positive regulation of metabolic process
GO:0031323	0.460	regulation of cellular metabolic process
GO:0031349	0.417	positive regulation of defense response
GO:0002831	0.401	regulation of response to biotic stimulus
GO:0032103	0.385	positive regulation of response to external stimulus
GO:0010940	0.385	positive regulation of necrotic cell death
GO:0002376	0.383	immune system process
GO:0045088	0.382	regulation of innate immune response
GO:0062098	0.381	regulation of programmed necrotic cell death
GO:0002684	0.370	positive regulation of immune system process
GO:0009966	0.370	regulation of signal transduction
GO:0051716	0.365	cellular response to stimulus
GO:0019219	0.363	regulation of nucleobase-containing compound metabolic process
GO:0010647	0.351	positive regulation of cell communication
GO:0050778	0.350	positive regulation of immune response
GO:0009967	0.341	positive regulation of signal transduction
GO:0009889	0.335	regulation of biosynthetic process
GO:0031326	0.329	regulation of cellular biosynthetic process
GO:0010556	0.323	regulation of macromolecule biosynthetic process
GO:0007154	0.306	cell communication
GO:0007165	0.301	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0070013	0.729	intracellular organelle lumen
GO:0016020	0.383	membrane
GO:0031981	0.376	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]