StarFunc result for job id Q9H172

User Input

>input (646 residues)
MAEKALEAVGCGLGPGAVAMAVTLEDGAEPPVLTTHLKKVENHITEAQRFSHLPKRSAVD
IEFVELSYSVREGPCWRKRGYKTLLKCLSGKFCRRELIGIMGPSGAGKSTFMNILAGYRE
SGMKGQILVNGRPRELRTFRKMSCYIMQDDMLLPHLTVLEAMMVSANLKLSEKQEVKKEL
VTEILTALGLMSCSHTRTALLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVV
SLMKSLAQGGRTIICTIHQPSAKLFEMFDKLYILSQGQCIFKGVVTNLIPYLKGLGLHCP
TYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDP
IESHTFATSTLTQFCILFKRTFLSILRDTVLTHLRFMSHVVIGVLIGLLYLHIGDDASKV
FNNTGCLFFSMLFLMFAALMPTVLTFPLEMAVFMREHLNYWYSLKAYYLAKTMADVPFQV
VCPVVYCSIVYWMTGQPAETSRFLLFSALATATALVAQSLGLLIGAASNSLQVATFVGPV
TAIPVLLFSGFFVSFKTIPTYLQWSSYLSYVRYGFEGVILTIYGMERGDLTCLEERCPFR
EPQSILRALDVEDAKLYMDFLVLGIFFLALRLLAYLVLRYRVKSER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91WA9	0.969	0.969	3.342E-89	646	0.964	0.964	Q91WA9.pdb.gz	ABCG4_MOUSE ATP-binding cassette subfamily G member 4 OS=Mus musculus OX=10090 GN=Abcg4 PE=1 SV=2
2	AFDB:A4QNW0	0.892	0.857	1.218E-72	673	0.717	0.688	A4QNW0.pdb.gz	A4QNW0_DANRE ATP-binding cassette sub-family G member 1 OS=Danio rerio OX=7955 GN=abcg1 PE=2 SV=1
3	AFDB:P45844	0.899	0.857	1.440E-72	678	0.709	0.676	P45844.pdb.gz	ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens OX=9606 GN=ABCG1 PE=1 SV=3
4	AFDB:Q9VQY4	0.868	0.676	5.369E-60	832	0.536	0.416	Q9VQY4.pdb.gz	Q9VQY4_DROME ABC transporter expressed in trachea, isoform A OS=Drosophila melanogaster OX=7227 GN=Atet PE=3 SV=1
5	PDB:7r8eA	0.758	0.883	9.440E-54	548	0.659	0.777	7r8eA.pdb.gz	Molecular basis of cholesterol efflux via ABCG subfamily transporters.
6	AFDB:Q8T9E6	0.833	0.706	3.030E-48	766	0.382	0.322	Q8T9E6.pdb.gz	Q8T9E6_DROME SD03967p OS=Drosophila melanogaster OX=7227 GN=ABCG1 PE=2 SV=1
7	AFDB:Q0E8U2	0.800	0.847	8.691E-47	609	0.353	0.374	Q0E8U2.pdb.gz	Q0E8U2_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9664 PE=3 SV=1
8	AFDB:P10090	0.807	0.761	9.726E-41	687	0.322	0.303	P10090.pdb.gz	WHITE_DROME Protein white OS=Drosophila melanogaster OX=7227 GN=w PE=1 SV=2
9	AFDB:Q38AM7	0.813	0.813	2.158E-40	646	0.289	0.289	Q38AM7.pdb.gz	Q38AM7_TRYB2 ATP-binding cassette protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3320 PE=4 SV=1
10	AFDB:Q11180	0.773	0.745	1.263E-38	671	0.263	0.253	Q11180.pdb.gz	WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans OX=6239 GN=wht-1 PE=2 SV=3
11	AFDB:Q9C6W5	0.795	0.792	2.179E-38	648	0.282	0.281	Q9C6W5.pdb.gz	AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana OX=3702 GN=ABCG14 PE=1 SV=1
12	PDB:6hbuA	0.702	0.769	5.334E-33	584	0.259	0.286	6hbuA.pdb.gz	Cryo-EM structures of a human ABCG2 mutant trapped in ATP-bound and substrate-bound states.
13	PDB:7jr7B	0.766	0.851	1.195E-30	579	0.223	0.249	7jr7B.pdb.gz
14	PDB:7r89B	0.732	0.887	1.818E-30	529	0.212	0.259	7r89B.pdb.gz	Molecular basis of cholesterol efflux via ABCG subfamily transporters.
15	PDB:8cubC	0.785	0.859	1.362E-29	588	0.234	0.257	8cubC.pdb.gz	Structural Analysis of Cholesterol Binding and Sterol Selectivity by ABCG5/G8.
16	PDB:7p04A	0.776	0.384	8.666E-28	1353	0.226	0.108	7p04A.pdb.gz	Structure and efflux mechanism of the yeast pleiotropic drug resistance transporter Pdr5.
17	PDB:7p03A	0.724	0.369	1.218E-26	1333	0.229	0.111	7p03A.pdb.gz
18	PDB:5do7B	0.733	0.837	7.128E-25	562	0.217	0.249	5do7B.pdb.gz
19	PDB:7p06A	0.701	0.356	1.282E-24	1350	0.231	0.110	7p06A.pdb.gz	Structure and efflux mechanism of the yeast pleiotropic drug resistance transporter Pdr5.
20	PDB:6mbnA	0.328	0.815	3.547E-13	241	0.079	0.212	6mbnA.pdb.gz	Combining Mutations That Inhibit Two Distinct Steps of the ATP Hydrolysis Cycle Restores Wild-Type Function in the Lipopolysaccharide Transporter and Shows that ATP Binding Triggers Transport.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K987	0.0	926	664	0.707	0.688	A0A0G2K987_RAT ATP binding cassette subfamily G member 1 OS=Rattus norvegicus OX=10116 GN=Abcg1 PE=3 SV=2
2	A4QNW0	0.0	920	673	0.711	0.682	A4QNW0_DANRE ATP-binding cassette sub-family G member 1 OS=Danio rerio OX=7955 GN=abcg1 PE=2 SV=1
3	G3V642	0.0	928	666	0.707	0.686	G3V642_RAT ATP binding cassette subfamily G member 1 OS=Rattus norvegicus OX=10116 GN=Abcg1 PE=3 SV=3
4	P45844	0.0	924	678	0.711	0.677	ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens OX=9606 GN=ABCG1 PE=1 SV=3
5	Q64343	0.0	926	666	0.704	0.683	ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus OX=10090 GN=Abcg1 PE=1 SV=1
6	Q91WA9	0.0	1288	646	0.966	0.966	ABCG4_MOUSE ATP-binding cassette subfamily G member 4 OS=Mus musculus OX=10090 GN=Abcg4 PE=1 SV=2
7	Q9EPG9	0.0	927	666	0.706	0.685	Q9EPG9_RAT ABC transporter, white homologue OS=Rattus norvegicus OX=10116 GN=Abcg1 PE=2 SV=1
8	Q9H172	0.0	1331	646	1.000	1.000	ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens OX=9606 GN=ABCG4 PE=1 SV=2
9	Q0E8U2	1.51e-129	396	609	0.344	0.365	Q0E8U2_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9664 PE=3 SV=1
10	M9NEQ1	3.38e-128	393	608	0.339	0.360	M9NEQ1_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9664 PE=3 SV=1
11	Q9VQY4	1.20e-120	380	832	0.277	0.215	Q9VQY4_DROME ABC transporter expressed in trachea, isoform A OS=Drosophila melanogaster OX=7227 GN=Atet PE=3 SV=1
12	P10090	1.67e-106	339	687	0.314	0.295	WHITE_DROME Protein white OS=Drosophila melanogaster OX=7227 GN=w PE=1 SV=2
13	Q9C6W5	5.02e-87	286	648	0.293	0.292	AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana OX=3702 GN=ABCG14 PE=1 SV=1
14	Q11180	4.96e-84	279	671	0.257	0.247	WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans OX=6239 GN=wht-1 PE=2 SV=3
15	Q7TMS5	7.41e-81	270	657	0.259	0.254	ABCG2_MOUSE Broad substrate specificity ATP-binding cassette transporter ABCG2 OS=Mus musculus OX=10090 GN=Abcg2 PE=1 SV=1
16	Q80W57	7.65e-81	270	657	0.263	0.259	ABCG2_RAT Broad substrate specificity ATP-binding cassette transporter ABCG2 OS=Rattus norvegicus OX=10116 GN=Abcg2 PE=1 SV=1
17	Q2Q447	4.65e-80	268	643	0.279	0.280	Q2Q447_DANRE ATP-binding cassette sub-family G member 2 OS=Danio rerio OX=7955 GN=wu:fd59c01 PE=1 SV=1
18	Q8T9E6	1.25e-78	267	766	0.215	0.181	Q8T9E6_DROME SD03967p OS=Drosophila melanogaster OX=7227 GN=ABCG1 PE=2 SV=1
19	Q9UNQ0	1.93e-78	264	655	0.243	0.240	ABCG2_HUMAN Broad substrate specificity ATP-binding cassette transporter ABCG2 OS=Homo sapiens OX=9606 GN=ABCG2 PE=1 SV=3
20	Q38AM7	4.30e-78	263	646	0.268	0.268	Q38AM7_TRYB2 ATP-binding cassette protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3320 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	46	14.2	AAA domain
2	PF13238 AAA_18	3.8e+02	13.0	AAA domain
3	PF13304 AAA_21	0.004	28.6	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13476 AAA_23	9.1e+02	11.8	AAA domain
5	PF13555 AAA_29	3.3e+02	12.4	P-loop containing region of AAA domain
6	PF01061 ABC2_membrane	8.7e-45	164.3	ABC-2 type transporter
7	PF19055 ABC2_membrane_7	1.6e-12	58.7	ABC-2 type transporter
8	PF00005 ABC_tran	1.9e-21	88.5	ABC transporter
9	PF00350 Dynamin_N	5.8e+02	11.9	Dynamin family
10	PF03308 MeaB	1.4e+02	12.8	Methylmalonyl Co-A mutase-associated GTPase MeaB
11	PF01926 MMR_HSR1	1.4e+02	13.9	50S ribosome-binding GTPase
12	PF00485 PRK	5.8e+02	11.6	Phosphoribulokinase / Uridine kinase family
13	PF03215 Rad17	1.8e+02	13.4	Rad17 P-loop domain
14	PF03193 RsgA_GTPase	12	17.3	RsgA GTPase
15	PF02463 SMC_N	0.0052	27.8	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010355265.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010353067.1	0.675	Cubilin
2	61622.XP_010364494.1	0.660	ATP binding cassette subfamily F member 3
3	61622.XP_010367840.1	0.655	Nuclear receptor subfamily 1 group H member 2
4	61622.XP_010369399.1	0.655	Nuclear receptor subfamily 1 group H member 3
5	61622.XP_010352720.1	0.652	Low-density lipoprotein receptor-related protein 2
6	61622.XP_010377377.1	0.640	Solute carrier organic anion transporter family member 6A1 isoform X1
7	61622.XP_010375118.1	0.637	N(alpha)-acetyltransferase 40, NatD catalytic subunit
8	61622.XP_010380932.1	0.631	ATP-binding cassette sub-family D member 4 isoform X1
9	61622.XP_010352011.1	0.623	Protein amnionless
10	61622.XP_010352081.1	0.623	Protein amnionless
11	61622.XP_010369999.1	0.604	Apolipoprotein A-I
12	61622.XP_010363516.1	0.589	Solute carrier family 17 member 9
13	61622.XP_010351970.1	0.588	Belongs to the cytochrome P450 family.
14	61622.XP_010371340.1	0.588	Solute carrier family 29 member 3
15	61622.XP_010356212.1	0.579	Belongs to the eukaryotic ribosomal protein eS7 family.
16	61622.XP_010358582.1	0.567	ATP binding cassette subfamily B member 6 (Langereis blood group)
17	61622.XP_010375622.1	0.561	G protein pathway suppressor 2
18	61622.XP_010368063.1	0.558	Solute carrier family 29 member 1 (Augustine blood group)
19	61622.XP_010357207.1	0.549	ATP binding cassette subfamily C member 4
20	61622.XP_010351612.1	0.547	ATP binding cassette subfamily A member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140359	0.998	ABC-type transporter activity
GO:0015248	0.996	sterol transporter activity
GO:0042803	0.995	protein homodimerization activity
GO:0016817	0.991	hydrolase activity, acting on acid anhydrides
GO:0046982	0.989	protein heterodimerization activity
GO:1901618	0.971	organic hydroxy compound transmembrane transporter activity
GO:0017111	0.785	ribonucleoside triphosphate phosphatase activity
GO:0097159	0.689	organic cyclic compound binding
GO:0043167	0.629	ion binding
GO:1901363	0.579	heterocyclic compound binding
GO:0036094	0.490	small molecule binding
GO:0120020	0.350	cholesterol transfer activity
GO:0016887	0.339	ATP hydrolysis activity
GO:0043168	0.314	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015850	0.998	organic hydroxy compound transport
GO:0006869	0.998	lipid transport
GO:0030301	0.990	cholesterol transport
GO:0009987	0.879	cellular process
GO:0065007	0.868	biological regulation
GO:0050789	0.834	regulation of biological process
GO:0050794	0.608	regulation of cellular process
GO:0051049	0.521	regulation of transport
GO:0050896	0.474	response to stimulus
GO:0008152	0.401	metabolic process
GO:0071704	0.349	organic substance metabolic process
GO:0048518	0.327	positive regulation of biological process
GO:0042221	0.324	response to chemical
GO:0051716	0.302	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043227	0.993	membrane-bounded organelle
GO:0012505	0.983	endomembrane system
GO:0005622	0.955	intracellular anatomical structure
GO:0043231	0.938	intracellular membrane-bounded organelle
GO:0005737	0.924	cytoplasm
GO:0031090	0.906	organelle membrane
GO:0031982	0.864	vesicle
GO:0031410	0.748	cytoplasmic vesicle
GO:0098588	0.726	bounding membrane of organelle
GO:0005768	0.386	endosome
GO:0030659	0.332	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.999	Translocases.
RHEA:39747	0.996	cholesterol(in) = cholesterol(out)
EC:3.6.-.-	0.991	Acting on acid anhydrides.
RHEA:23680	0.785	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.785	nucleoside-triphosphate phosphatase.
RHEA:13065	0.339	ATP + H2O = ADP + H(+) + phosphate

[back to server]