StarFunc result for job id Q9H1A3

User Input

>input (318 residues)
MRLLAGWLCLSLASVWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCN
REKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGL
LGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMI
WQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILAL
VLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGD
MYNDYYVLDDAVFVLKPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EPL4	0.872	0.872	2.785E-66	318	0.972	0.972	Q9EPL4.pdb.gz	METL9_MOUSE Protein-L-histidine N-pros-methyltransferase OS=Mus musculus OX=10090 GN=Mettl9 PE=1 SV=1
2	AFDB:Q584Q2	0.747	0.745	2.013E-27	319	0.321	0.320	Q584Q2.pdb.gz	Q584Q2_TRYB2 DREV methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.1160 PE=4 SV=1
3	AFDB:O74386	0.429	0.533	5.256E-10	248	0.126	0.161	O74386.pdb.gz	TR141_SCHPO tRNA N(3)-methylcytidine methyltransferase trm141 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm141 PE=1 SV=1
4	AFDB:O95050	0.400	0.472	1.993E-9	263	0.138	0.167	O95050.pdb.gz	INMT_HUMAN Indolethylamine N-methyltransferase OS=Homo sapiens OX=9606 GN=INMT PE=1 SV=3
5	PDB:7d8fA	0.369	0.479	2.549E-9	234	0.151	0.205	7d8fA.pdb.gz	Structural Basis for Peptide Binding of Alpha-N Terminal Methyltransferase from Saccharomyces cerevisiae
6	PDB:1qzzA	0.354	0.333	3.667E-9	340	0.107	0.100	1qzzA.pdb.gz	Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
7	AFDB:A0A024R8E4	0.392	0.534	3.880E-9	223	0.142	0.202	A0A024R8E4.pdb.gz
8	AFDB:Q8BVH9	0.394	0.436	4.122E-9	282	0.116	0.131	Q8BVH9.pdb.gz	METL6_MOUSE tRNA N(3)-methylcytidine methyltransferase METTL6 OS=Mus musculus OX=10090 GN=Mettl6 PE=1 SV=2
9	AFDB:Q9NZJ6	0.399	0.350	5.253E-9	369	0.129	0.111	Q9NZJ6.pdb.gz	COQ3_HUMAN Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ3 PE=1 SV=3
10	PDB:2a14A	0.389	0.469	7.140E-9	257	0.110	0.136	2a14A.pdb.gz	The Crystal Structure of Human Indolethylamine N-methyltransferase in complex with SAH.
11	AFDB:Q582P2	0.382	0.175	7.555E-9	749	0.123	0.052	Q582P2.pdb.gz	Q582P2_TRYB2 Generic methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.700 PE=4 SV=1
12	AFDB:Q5BIB9	0.383	0.407	7.555E-9	297	0.135	0.145	Q5BIB9.pdb.gz	Q5BIB9_DROME RE17490p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Coq3 PE=2 SV=1
13	PDB:6orrC	0.400	0.455	7.586E-9	273	0.138	0.161	6orrC.pdb.gz	High-Affinity Alkynyl Bisubstrate Inhibitors of NicotinamideN-Methyltransferase (NNMT).
14	AFDB:Q584S3	0.379	0.469	8.528E-9	250	0.119	0.152	Q584S3.pdb.gz	Q584S3_TRYB2 RGG protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.660 PE=3 SV=1
15	PDB:5wp5A	0.366	0.265	2.000E-8	463	0.145	0.099	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
16	PDB:1tw2B	0.360	0.330	4.670E-8	350	0.129	0.117	1tw2B.pdb.gz	Crystal structure of a ternary complex of DnrK, a methyltransferase in daunorubicin biosynthesis, with bound products
17	PDB:2i62B	0.405	0.481	6.321E-8	261	0.132	0.161	2i62B.pdb.gz	The Crystal Structure of Mouse Nicotinamide N-methyltransferase in complex with SAH
18	PDB:6dtnB	0.396	0.518	8.055E-8	233	0.145	0.197	6dtnB.pdb.gz	Discovery of Bisubstrate Inhibitors for Protein N-Terminal Methyltransferase 1.
19	PDB:4kdcA	0.340	0.474	8.558E-8	217	0.079	0.115	4kdcA.pdb.gz
20	PDB:4hh4C	0.338	0.413	1.389E-7	256	0.116	0.145	4hh4C.pdb.gz	Structure and possible mechanism of the CcbJ methyltransferase from Streptomyces caelestis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9EPL4	0.0	646	318	0.972	0.972	METL9_MOUSE Protein-L-histidine N-pros-methyltransferase OS=Mus musculus OX=10090 GN=Mettl9 PE=1 SV=1
2	Q9H1A3	0.0	660	318	1.000	1.000	METL9_HUMAN Protein-L-histidine N-pros-methyltransferase OS=Homo sapiens OX=9606 GN=METTL9 PE=1 SV=1
3	Q584Q2	1.19e-42	151	319	0.311	0.310	Q584Q2_TRYB2 DREV methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.1160 PE=4 SV=1
4	Q3U1N2	0.024	38.9	1130	0.129	0.036	SRBP2_MOUSE Sterol regulatory element-binding protein 2 OS=Mus musculus OX=10090 GN=Srebf2 PE=1 SV=2
5	Q12772	0.041	38.1	1141	0.123	0.034	SRBP2_HUMAN Sterol regulatory element-binding protein 2 OS=Homo sapiens OX=9606 GN=SREBF2 PE=1 SV=2
6	Q60429	0.041	38.1	1139	0.113	0.032	SRBP2_CRIGR Sterol regulatory element-binding protein 2 OS=Cricetulus griseus OX=10029 GN=SREBF2 PE=2 SV=1
7	Q6DNE3	0.21	36.2	2298	0.097	0.013	Q6DNE3_9CYAN CurJ OS=Lyngbya majuscula OX=158786 GN=curJ PE=1 SV=1
8	Q9BV86	0.23	35.0	223	0.094	0.135	NTM1A_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=NTMT1 PE=1 SV=3
9	Q3T1I5	0.42	35.0	1133	0.110	0.031	SRBP2_RAT Sterol regulatory element-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Srebf2 PE=2 SV=1
10	O74421	0.48	34.3	274	0.075	0.088	COQ3_SCHPO Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq3 PE=3 SV=2
11	P27680	0.53	34.3	312	0.041	0.042	COQ3_YEAST Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ3 PE=1 SV=2
12	M9MRD4	0.73	34.3	8382	0.079	0.003	M9MRD4_DROME Muscle-specific protein 300 kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
13	M9PC84	0.95	33.9	12308	0.079	0.002	M9PC84_DROME Muscle-specific protein 300 kDa, isoform L OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
14	M9MRD1	0.99	33.9	12345	0.079	0.002	MS300_DROME Muscle-specific protein 300 kDa OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
15	Q6UX53	0.99	33.1	244	0.088	0.115	TMT1B_HUMAN Thiol S-methyltransferase TMT1B OS=Homo sapiens OX=9606 GN=TMT1B PE=1 SV=2
16	M9MRD6	1.0	33.9	11999	0.079	0.002	M9MRD6_DROME Muscle-specific protein 300 kDa, isoform I OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
17	M9MRF5	1.0	33.9	11986	0.079	0.002	M9MRF5_DROME Muscle-specific protein 300 kDa, isoform H OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
18	M9PCM8	1.1	33.9	11917	0.079	0.002	M9PCM8_DROME Muscle-specific protein 300 kDa, isoform K OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
19	O53532	1.2	33.1	353	0.094	0.085	Y2258_MYCTU S-adenosylmethionine-dependent methyltransferase Rv2258c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2258c PE=1 SV=1
20	M9PC23	1.3	33.5	7962	0.079	0.003	M9PC23_DROME Muscle-specific protein 300 kDa, isoform J OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05219 DREV	2.4e-136	464.6	DREV methyltransferase
2	PF08241 Methyltransf_11	0.0095	27.9	Methyltransferase domain
3	PF08242 Methyltransf_12	0.00011	34.2	Methyltransferase domain
4	PF13489 Methyltransf_23	3.2e-07	41.8	Methyltransferase domain
5	PF13649 Methyltransf_25	0.026	26.5	Methyltransferase domain
6	PF13847 Methyltransf_31	6.7e+02	11.5	Methyltransferase domain
7	PF05891 Methyltransf_PK	4.3e+02	11.8	AdoMet dependent proline di-methyltransferase
8	PF05175 MTS	1.6e+02	13.3	Methyltransferase small domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350874

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268389	0.941	Immunoglobulin superfamily member 6
2	9606.ENSP00000248306	0.788	Methyltransferase-like protein 25
3	9606.ENSP00000344071	0.786	Methyltransferase-like protein 24
4	9606.ENSP00000357829	0.751	EEF1A lysine methyltransferase 2
5	9606.ENSP00000263092	0.730	U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
6	9606.ENSP00000357199	0.729	Protein RRNAD1
7	9606.ENSP00000354920	0.727	Methyltransferase-like protein 13
8	9606.ENSP00000480056	0.725	Methyltransferase-like protein 8
9	9606.ENSP00000370718	0.682	N-acetylserotonin O-methyltransferase-like protein
10	9606.ENSP00000382163	0.667	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
11	9606.ENSP00000368793	0.666	Peptide chain release factor 1, mitochondrial
12	9606.ENSP00000267273	0.629	Protein-lysine methyltransferase METTL21C
13	9606.ENSP00000356202	0.600	Peptide chain release factor 1-like, mitochondrial
14	9606.ENSP00000260803	0.590	Lariat debranching enzyme
15	9606.ENSP00000367346	0.574	Arginine-hydroxylase NDUFAF5, mitochondrial
16	9606.ENSP00000258955	0.572	Radical S-adenosyl methionine domain-containing protein 1, mitochondrial
17	9606.ENSP00000361363	0.517	DNA methyltransferase 1-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008757	1.000	S-adenosylmethionine-dependent methyltransferase activity
GO:0008170	1.000	N-methyltransferase activity
GO:0008276	1.000	protein methyltransferase activity
GO:0005515	0.985	protein binding
GO:0106370	0.903	protein-L-histidine N-pros-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0043170	0.980	macromolecule metabolic process
GO:0044238	0.977	primary metabolic process
GO:0006807	0.919	nitrogen compound metabolic process
GO:0043412	0.829	macromolecule modification
GO:0044260	0.765	cellular macromolecule metabolic process
GO:1901564	0.724	organonitrogen compound metabolic process
GO:0019538	0.674	protein metabolic process
GO:0065007	0.655	biological regulation
GO:0032259	0.604	methylation
GO:0043414	0.594	macromolecule methylation
GO:0050789	0.561	regulation of biological process
GO:0050794	0.542	regulation of cellular process
GO:0036211	0.450	protein modification process
GO:0006479	0.309	protein methylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.992	endomembrane system
GO:0005783	0.980	endoplasmic reticulum
GO:0070013	0.768	intracellular organelle lumen
GO:0005634	0.497	nucleus
GO:0005829	0.409	cytosol
GO:0016020	0.380	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.
RHEA:67076	0.903	L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(pros)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine

[back to server]