StarFunc result for job id Q9H1A4

User Input

>input (1944 residues)
MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGS
LQEVTIHEKQKESWQLRKGVSEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVD
SPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCINMHSIEGKDYIASLPFQVANV
WPTKYGLLFERSASSHEVPPGSPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFSEQGGTPQNVATSSS
LTAHLRSLSKGDSPVTSPFQNYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGV
HSFSGVQRFNISSHNQSPKRHSISHSPNSNSNGSFLAPETEPIVPELCIDHLWTETITNI
REKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAA
PVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKP
LSKLLGSLDEVVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELS
NGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPGGPSYHSEWNLF
VTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVE
SHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMG
EGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSE
PPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILGDESLVSDESSQYLTRIT
IAPQKLQVEQEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIY
HCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMN
HEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMAL
PVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNG
VAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLV
YQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLN
VPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNN
RSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLS
APNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHM
ALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLV
PVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDL
SKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISA
FTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRL
GRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWL
QVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQ
LKMPVRALLRLAPLLLGNPQPMVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5khrA	0.701	0.977	0.000	1391	0.710	0.993	5khrA.pdb.gz
2	PDB:5l9tA	0.696	0.978	0.000	1380	0.703	0.990	5l9tA.pdb.gz
3	PDB:5lcwA	0.718	0.965	0.000	1441	0.727	0.981	5lcwA.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
4	PDB:6q6hA	0.790	0.989	0.000	1551	0.792	0.992	6q6hA.pdb.gz	Cyclin A2 degradation during the spindle assembly checkpoint requires multiple binding modes to the APC/C.
5	PDB:6tntA	0.743	0.902	0.000	1583	0.806	0.989	6tntA.pdb.gz	Molecular mechanisms of APC/C release from spindle assembly checkpoint inhibition by APC/C SUMOylation.
6	PDB:7qe7A	0.836	0.985	0.000	1648	0.844	0.996	7qe7A.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
7	AFDB:P53995	0.976	0.976	0.000	1944	0.923	0.923	P53995.pdb.gz	APC1_MOUSE Anaphase-promoting complex subunit 1 OS=Mus musculus OX=10090 GN=Anapc1 PE=1 SV=2
8	AFDB:Q584X1	0.332	0.351	4.726E-52	1837	0.199	0.210	Q584X1.pdb.gz	Q584X1_TRYB2 Cyclosome subunit 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.710 PE=3 SV=1
9	PDB:8a3tC	0.542	0.726	4.145E-42	1410	0.174	0.240	8a3tC.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
10	PDB:5l4kN	0.199	0.409	9.364E-8	876	0.066	0.147	5l4kN.pdb.gz
11	PDB:6fvtN	0.179	0.352	2.807E-7	922	0.070	0.148	6fvtN.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
12	PDB:4cr2Z	0.189	0.413	1.431E-6	813	0.068	0.164	4cr2Z.pdb.gz	Deep Classification of a Large Cryo-Em Dataset Defines the Conformational Landscape of the 26S Proteasome.
13	AFDB:O35927	0.058	0.079	6.636E-3	1247	0.086	0.134	O35927.pdb.gz	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
14	AFDB:Q9UQB3	0.063	0.088	1.608E-2	1225	0.083	0.132	Q9UQB3.pdb.gz	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
15	AFDB:Q99959	0.059	0.102	3.383E-2	881	0.064	0.141	Q99959.pdb.gz	PKP2_HUMAN Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2 PE=1 SV=2
16	AFDB:Q7Z5K2	0.071	0.096	5.753E-2	1190	0.080	0.131	Q7Z5K2.pdb.gz	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
17	AFDB:Q6ZS17	0.052	0.075	1.168E-1	1223	0.082	0.131	Q6ZS17.pdb.gz	RIPR1_HUMAN Rho family-interacting cell polarization regulator 1 OS=Homo sapiens OX=9606 GN=RIPOR1 PE=1 SV=1
18	AFDB:G5E870	0.077	0.074	2.133E-1	2025	0.075	0.072	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
19	AFDB:Q4GZ31	0.045	0.056	2.372E-1	1443	0.059	0.080	Q4GZ31.pdb.gz	Q4GZ31_TRYB2 WD repeat protein mio zinc-ribbon like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1880 PE=4 SV=1
20	AFDB:A0A1D8PLL4	0.052	0.075	2.637E-1	1027	0.074	0.139	A0A1D8PLL4.pdb.gz	A0A1D8PLL4_CANAL Rgt1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RGT1 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P53995	0.0	3713	1944	0.924	0.924	APC1_MOUSE Anaphase-promoting complex subunit 1 OS=Mus musculus OX=10090 GN=Anapc1 PE=1 SV=2
2	Q9H1A4	0.0	4029	1944	1.000	1.000	APC1_HUMAN Anaphase-promoting complex subunit 1 OS=Homo sapiens OX=9606 GN=ANAPC1 PE=1 SV=1
3	Q9VXV3	0.0	1022	2030	0.350	0.335	Q9VXV3_DROME Shattered OS=Drosophila melanogaster OX=7227 GN=shtd PE=1 SV=1
4	Q54NC6	3.60e-168	570	2269	0.184	0.157	APC1_DICDI Anaphase-promoting complex subunit 1 OS=Dictyostelium discoideum OX=44689 GN=anapc1 PE=3 SV=1
5	Q9FFF9	9.83e-167	556	1678	0.226	0.262	APC1_ARATH Anaphase-promoting complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=APC1 PE=2 SV=1
6	Q9URV2	1.84e-129	446	1458	0.184	0.245	APC1_SCHPO Anaphase-promoting complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut4 PE=1 SV=1
7	O18191	2.88e-83	305	1505	0.126	0.162	APC1_CAEEL Anaphase-promoting complex subunit 1 OS=Caenorhabditis elegans OX=6239 GN=mat-2 PE=1 SV=3
8	Q584X1	1.97e-73	275	1837	0.159	0.168	Q584X1_TRYB2 Cyclosome subunit 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.710 PE=3 SV=1
9	Q960S7	3.23e-72	253	491	0.081	0.322	Q960S7_DROME LD37115p OS=Drosophila melanogaster OX=7227 GN=shtd PE=2 SV=1
10	P53886	3.19e-49	196	1748	0.123	0.137	APC1_YEAST Anaphase-promoting complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=APC1 PE=1 SV=2
11	Q80UK5	0.96	36.6	377	0.014	0.072	Q80UK5_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9f OS=Mus musculus OX=10090 GN=Serpinb9f PE=2 SV=1
12	Q8VI95	0.97	36.6	361	0.013	0.072	OAS1D_MOUSE Inactive 2'-5'-oligoadenylate synthase 1D OS=Mus musculus OX=10090 GN=Oas1d PE=1 SV=1
13	P53332	4.3	34.3	305	0.014	0.089	COAD_YEAST Phosphopantetheine adenylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAB4 PE=1 SV=1
14	P87048	6.4	34.3	891	0.024	0.053	RPN1_SCHPO 26S proteasome regulatory subunit rpn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn1 PE=1 SV=2
15	A0A1D8PGI8	6.7	33.9	371	0.017	0.089	A0A1D8PGI8_CANAL Phospho-2-dehydro-3-deoxyheptonate aldolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARO3 PE=3 SV=1
16	Q580S3	7.7	33.9	911	0.019	0.041	Q580S3_TRYB2 26S proteasome regulatory non-ATPase subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.730 PE=3 SV=1
17	Q8WRU8	7.9	33.9	911	0.019	0.041	Q8WRU8_9TRYP Proteasome regulatory non-ATP-ase subunit 1 OS=Trypanosoma brucei OX=5691 GN=Rpn1 PE=2 SV=1
18	Q7TP21	8.1	33.9	680	0.009	0.026	Q7TP21_RAT Replication protein A subunit OS=Rattus norvegicus OX=10116 GN=Rpa1 PE=1 SV=1
19	Q9GZH5	8.4	33.9	981	0.022	0.044	Q9GZH5_CAEEL 26S proteasome non-ATPase regulatory subunit 2 OS=Caenorhabditis elegans OX=6239 GN=rpn-1 PE=1 SV=1
20	A0A0G2KAT3	8.6	33.5	603	0.009	0.030	A0A0G2KAT3_RAT Replication protein A subunit OS=Rattus norvegicus OX=10116 GN=Rpa1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12859 ANAPC1	6.5e-12	57.4	Anaphase-promoting complex subunit 1 WD40 beta-propeller domain
2	PF18122 APC1_C	8.4e-37	138.2	Anaphase-promoting complex sub unit 1 C-terminal domain
3	PF20518 Apc1_MidN	1.3e-267	898.3	Anaphase-promoting complex subunit 1 middle domain
4	PF19521 Apc1_N	4.4e-80	277.8	Anaphase-promoting complex subunit 1 N-terminal
5	PF01851 PC_rep	0.018	26.6	Proteasome/cyclosome repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339109

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261819	0.999	Anaphase-promoting complex subunit 5
2	9606.ENSP00000314004	0.999	Anaphase-promoting complex subunit 2
3	9606.ENSP00000353549	0.999	Cell division cycle protein 16 homolog
4	9606.ENSP00000361540	0.999	Cell division cycle protein 20 homolog
5	9606.ENSP00000378350	0.999	Cell division cycle protein 23 homolog
6	9606.ENSP00000378529	0.999	Fizzy-related protein homolog
7	9606.ENSP00000394394	0.999	Anaphase-promoting complex subunit 7
8	9606.ENSP00000426654	0.999	Anaphase-promoting complex subunit 4
9	9606.ENSP00000434614	0.999	Cell division cycle protein 27 homolog
10	9606.ENSP00000478501	0.999	Anaphase-promoting complex subunit 10
11	9606.ENSP00000287598	0.998	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
12	9606.ENSP00000349957	0.998	Anaphase promoting complex subunit 11
13	9606.ENSP00000363322	0.998	Anaphase-promoting complex subunit CDC26
14	9606.ENSP00000421842	0.998	Anaphase-promoting complex subunit 13
15	9606.ENSP00000477760	0.998	Anaphase-promoting complex subunit 16
16	9606.ENSP00000439403	0.996	Anaphase-promoting complex subunit 15
17	9606.ENSP00000296509	0.985	Mitotic spindle assembly checkpoint protein MAD2A
18	9606.ENSP00000348838	0.982	Ubiquitin-conjugating enzyme E2 C
19	9606.ENSP00000355966	0.979	Serine/threonine-protein kinase Nek2
20	9606.ENSP00000357858	0.954	Mitotic checkpoint protein BUB3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.337	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016567	0.993	protein ubiquitination
GO:0000209	0.975	protein polyubiquitination
GO:0009987	0.755	cellular process
GO:0050789	0.539	regulation of biological process
GO:0050794	0.511	regulation of cellular process
GO:0044237	0.309	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.997	protein-containing complex
GO:0005829	0.986	cytosol
GO:1902494	0.961	catalytic complex
GO:0140535	0.931	intracellular protein-containing complex
GO:1990234	0.894	transferase complex
GO:0140513	0.891	nuclear protein-containing complex
GO:0000151	0.879	ubiquitin ligase complex
GO:0000152	0.844	nuclear ubiquitin ligase complex
GO:0031461	0.730	cullin-RING ubiquitin ligase complex
GO:0005680	0.717	anaphase-promoting complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]