StarFunc result for job id Q9H1B7

User Input

>input (796 residues)
MSAAQVSSSRRQSCYLCDLPRMPWAMIWDFSEPVCRGCVNYEGADRIEFVIETARQLKRA
HGCFQDGRSPGPPPPVGVKTVALSAKEAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQ
QQQQQQQLNHVDGSSKPAVLAAPSGLERYGLSAAAAAAAAAAAAVEQRSRFEYPPPPVSL
GSSSHTARLPNGLGGPNGFPKPTPEEGPPELNRQSPNSSSAAASVASRRGTHGGLVTGLP
NPGGGGGPQLTVPPNLLPQTLLNGPASAAVLPPPPPHALGSRGPPTPAPPGAPGGPACLG
GTPGVSATSSSASSSTSSSVAEVGVGAGGKRPGSVSSTDQERELKEKQRNAEALAELSES
LRNRAEEWASKPKMVRDTLLTLAGCTPYEVRFKKDHSLLGRVFAFDAVSKPGMDYELKLF
IEYPTGSGNVYSSASGVAKQMYQDCMKDFGRGLSSGFKYLEYEKKHGSGDWRLLGDLLPE
AVRFFKEGVPGADMLPQPYLDASCPMLPTALVSLSRAPSAPPGTGALPPAAPSGRGAAAS
LRKRKASPEPPDSAEGALKLGEEQQRQQWMANQSEALKLTMSAGGFAAPGHAAGGPPPPP
PPLGPHSNRTTPPESAPQNGPSPMAALMSVADTLGTAHSPKDGSSVHSTTASARRNSSSP
VSPASVPGQRRLASRNGDLNLQVAPPPPSAHPGMDQVHPQNIPDSPMANSGPLCCTICHE
RLEDTHFVQCPSVPSHKFCFPCSRESIKAQGATGEVYCPSGEKCPLVGSNVPWAFMQGEI
ATILAGDVKVKKERDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H1B7	1.000	1.000	0.000	796	1.000	1.000	Q9H1B7.pdb.gz	I2BPL_HUMAN Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1
2	AFDB:Q7T2G1	0.157	0.233	5.357E-31	501	0.374	0.595	Q7T2G1.pdb.gz	I2B2B_DANRE Interferon regulatory factor 2-binding protein 2-B OS=Danio rerio OX=7955 GN=irf2bp2b PE=2 SV=1
3	AFDB:B7Z143	0.137	0.166	1.467E-21	630	0.271	0.343	B7Z143.pdb.gz	B7Z143_DROME Protein interacting with Ttk69 and Sin3A, isoform D OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=1
4	AFDB:M9PHN7	0.125	0.162	4.171E-20	585	0.255	0.347	M9PHN7.pdb.gz	M9PHN7_DROME Protein interacting with Ttk69 and Sin3A, isoform E OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=1
5	AFDB:Q7Z6E9	0.042	0.026	4.244E-2	1792	0.165	0.073	Q7Z6E9.pdb.gz	RBBP6_HUMAN E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1
6	AFDB:M9PHU0	0.065	0.025	8.587E-2	2263	0.156	0.055	M9PHU0.pdb.gz	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
7	AFDB:A8JNQ4	0.064	0.064	1.457E-1	796	0.177	0.177	A8JNQ4.pdb.gz	A8JNQ4_DROME RNA-binding Fox protein 1, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=4 SV=2
8	AFDB:Q8N5H7	0.068	0.064	1.638E-1	860	0.108	0.100	Q8N5H7.pdb.gz	SH2D3_HUMAN SH2 domain-containing protein 3C OS=Homo sapiens OX=9606 GN=SH2D3C PE=1 SV=1
9	PDB:7od1A	0.063	0.110	1.706E-1	430	0.021	0.040	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
10	PDB:7b5lH	0.065	0.112	2.289E-1	423	0.019	0.035	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
11	PDB:4kblA	0.069	0.134	2.895E-1	395	0.019	0.038	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
12	AFDB:Q494P4	0.046	0.059	2.948E-1	607	0.143	0.188	Q494P4.pdb.gz	Q494P4_ARATH At2g40070 OS=Arabidopsis thaliana OX=3702 GN=BPP1 PE=1 SV=1
13	AFDB:Q4WCP6	0.052	0.047	3.126E-1	881	0.143	0.129	Q4WCP6.pdb.gz	Q4WCP6_ASPFU GATA transcriptional activator AreA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G01970 PE=4 SV=1
14	PDB:2m1sA	0.054	0.258	4.911E-1	99	0.033	0.263	2m1sA.pdb.gz	Structural characterization of the Z RING-eIF4E complex reveals a distinct mode of control for eIF4E
15	PDB:7oniH	0.063	0.118	5.523E-1	380	0.014	0.029	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:4kfzB	0.044	0.223	1.413	148	0.009	0.047	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
17	PDB:1kfuL	0.053	0.060	1.788	699	0.008	0.009	1kfuL.pdb.gz
18	PDB:7d4iM4	0.041	0.035	2.010	978	0.020	0.016	7d4iM4.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
19	PDB:6bm7E	0.033	0.070	2.261	291	0.014	0.038	6bm7E.pdb.gz	Species-Selective Pyrimidineamine Inhibitors of Trypanosoma brucei S-Adenosylmethionine Decarboxylase.
20	PDB:7qdyA	0.039	0.028	2.398	1169	0.018	0.012	7qdyA.pdb.gz	The human SKI complex regulates channeling of ribosome-bound RNA to the exosome via an intrinsic gatekeeping mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2MJS2	0.0	1582	794	0.991	0.994	I2BPL_MACMU Probable E3 ubiquitin-protein ligase IRF2BPL OS=Macaca mulatta OX=9544 GN=IRF2BPL PE=2 SV=1
2	Q5EIC4	0.0	1525	783	0.962	0.978	I2BPL_RAT Probable E3 ubiquitin-protein ligase IRF2BPL OS=Rattus norvegicus OX=10116 GN=Irf2bpl PE=1 SV=1
3	Q9H1B7	0.0	1598	796	1.000	1.000	I2BPL_HUMAN Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1
4	Q8IU81	5.71e-128	396	584	0.305	0.416	I2BP1_HUMAN Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1
5	Q7Z5L9	1.18e-81	275	587	0.192	0.261	I2BP2_HUMAN Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2
6	Q7T2G1	2.42e-79	266	501	0.214	0.339	I2B2B_DANRE Interferon regulatory factor 2-binding protein 2-B OS=Danio rerio OX=7955 GN=irf2bp2b PE=2 SV=1
7	M9PHN7	1.17e-34	142	585	0.079	0.108	M9PHN7_DROME Protein interacting with Ttk69 and Sin3A, isoform E OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=1
8	Q8MS22	1.30e-34	142	615	0.079	0.102	Q8MS22_DROME RE41430p OS=Drosophila melanogaster OX=7227 GN=Pits PE=2 SV=1
9	Q9VYL7	1.30e-34	142	615	0.079	0.102	Q9VYL7_DROME Protein interacting with Ttk69 and Sin3A, isoform C OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=2
10	B7Z143	1.64e-34	142	630	0.079	0.100	B7Z143_DROME Protein interacting with Ttk69 and Sin3A, isoform D OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=1
11	P92004	7.55e-32	132	457	0.070	0.123	P92004_CAEEL Interferon regulatory factor 2-binding protein 1 & 2 zinc finger domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tag-260 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05918 API5	3.4e+02	11.4	Apoptosis inhibitory protein 5 (API5)
2	PF10846 DUF2722	0.25	21.9	Protein of unknown function (DUF2722)
3	PF11261 IRF-2BP1_2	6.9e-32	120.1	Interferon regulatory factor 2-binding protein zinc finger
4	PF03153 TFIIA	11	17.6	Transcription factor IIA, alpha/beta subunit
5	PF09534 Trp_oprn_chp	1.4e+02	13.7	Tryptophan-associated transmembrane protein (Trp_oprn_chp)
6	PF00097 zf-C3HC4	9.3	17.5	Zinc finger, C3HC4 type (RING finger)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000238647

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377218	0.855	Interferon regulatory factor 2
2	9606.ENSP00000307265	0.800	Interferon regulatory factor 2-binding protein 1
3	9606.ENSP00000404251	0.747	Transcription cofactor vestigial-like protein 4
4	9606.ENSP00000355568	0.731	Interferon regulatory factor 2-binding protein 2
5	9606.ENSP00000276414	0.720	Progonadoliberin-1
6	9606.ENSP00000264716	0.668	Fos-related antigen 2
7	9606.ENSP00000346879	0.588	Homeobox protein Nkx-2.1
8	9606.ENSP00000356162	0.561	Metastasis-suppressor KiSS-1
9	9606.ENSP00000313159	0.554	F-box only protein 34
10	9606.ENSP00000378588	0.522	Mitochondrial import inner membrane translocase subunit Tim9
11	9606.ENSP00000364699	0.518	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
12	9606.ENSP00000234371	0.505	KiSS-1 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0003676	0.509	nucleic acid binding
GO:0140110	0.481	transcription regulator activity
GO:0003677	0.417	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.956	developmental process
GO:0000003	0.910	reproduction
GO:0050789	0.909	regulation of biological process
GO:0050794	0.901	regulation of cellular process
GO:0019222	0.800	regulation of metabolic process
GO:0051171	0.787	regulation of nitrogen compound metabolic process
GO:0080090	0.785	regulation of primary metabolic process
GO:0060255	0.778	regulation of macromolecule metabolic process
GO:0031323	0.777	regulation of cellular metabolic process
GO:0019219	0.699	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.698	regulation of gene expression
GO:0051252	0.681	regulation of RNA metabolic process
GO:0009889	0.676	regulation of biosynthetic process
GO:0010556	0.667	regulation of macromolecule biosynthetic process
GO:0031326	0.662	regulation of cellular biosynthetic process
GO:0048519	0.652	negative regulation of biological process
GO:0048523	0.635	negative regulation of cellular process
GO:0006355	0.635	regulation of DNA-templated transcription
GO:0006357	0.606	regulation of transcription by RNA polymerase II
GO:0048522	0.587	positive regulation of cellular process
GO:0031325	0.512	positive regulation of cellular metabolic process
GO:0022414	0.478	reproductive process
GO:0009987	0.462	cellular process
GO:0045893	0.450	positive regulation of DNA-templated transcription
GO:0000122	0.432	negative regulation of transcription by RNA polymerase II
GO:0032501	0.418	multicellular organismal process
GO:0003006	0.364	developmental process involved in reproduction
GO:0045944	0.302	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.985	intracellular organelle lumen
GO:0005654	0.981	nucleoplasm
GO:0005737	0.653	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]