StarFunc result for job id Q9H1C4

User Input

>input (597 residues)
MEAEPPLYPMAGAAGPQGDEDLLGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGV
LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPI
AALLYTPVLIRFFGTKWMMFLAVGIYALFVSTNYWERYYTLVPSAVALGMAIVPLWASMG
NYITRMAQKYHEYSHYKEQDGQGMKQRPPRGSHAPYLLVFQAIFYSFFHLSFACAQLPMI
YFLNHYLYDLNHTLYNVQSCGTNSHGILSGFNKTVLRTLPRSGNLIVVESVLMAVAFLAM
LLVLGLCGAAYRPTEEIDLRSVGWGNIFQLPFKHVRDYRLRHLVPFFIYSGFEVLFACTG
IALGYGVCSVGLERLAYLLVAYSLGASAASLLGLLGLWLPRPVPLVAGAGVHLLLTFILF
FWAPVPRVLQHSWILYVAAALWGVGSALNKTGLSTLLGILYEDKERQDFIFTIYHWWQAV
AIFTVYLGSSLHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYR
YLEEDNSDESDAEGEHGDGAEEEAPPAGPRPGPEPAGLGRRPCPYEQAQGGDGPEEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VCW4	0.945	0.944	4.514E-73	598	0.906	0.905	Q8VCW4.pdb.gz	UN93B_MOUSE Protein unc-93 homolog B1 OS=Mus musculus OX=10090 GN=Unc93b1 PE=1 SV=2
2	AFDB:A0A0A8LEX5	0.842	0.802	1.852E-56	627	0.608	0.579	A0A0A8LEX5.pdb.gz	A0A0A8LEX5_SALSA UNC93B1 (Fragment) OS=Salmo salar OX=8030 GN=UNC93B1 PE=2 SV=1
3	PDB:7c76B	0.786	0.967	1.062E-55	483	0.809	1.000	7c76B.pdb.gz
4	AFDB:F1QYA8	0.848	0.813	7.048E-55	623	0.593	0.568	F1QYA8.pdb.gz	F1QYA8_DANRE Protein unc-93 homolog B1 OS=Danio rerio OX=7955 GN=UNC93B1 PE=1 SV=1
5	AFDB:Q86WB7	0.630	0.809	2.327E-18	457	0.193	0.252	Q86WB7.pdb.gz	UN93A_HUMAN Protein unc-93 homolog A OS=Homo sapiens OX=9606 GN=UNC93A PE=1 SV=1
6	AFDB:Q93380	0.618	0.531	2.632E-17	705	0.161	0.136	Q93380.pdb.gz	UNC93_CAEEL Putative potassium channel regulatory protein unc-93 OS=Caenorhabditis elegans OX=6239 GN=unc-93 PE=1 SV=4
7	AFDB:B7YZU1	0.581	0.639	2.185E-15	536	0.161	0.179	B7YZU1.pdb.gz	B7YZU1_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2121 PE=1 SV=1
8	AFDB:Q94AA1	0.590	0.752	3.495E-14	464	0.146	0.188	Q94AA1.pdb.gz	UN933_ARATH UNC93-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At3g09470 PE=2 SV=1
9	AFDB:O43934	0.518	0.670	6.855E-11	449	0.124	0.165	O43934.pdb.gz	MFS11_HUMAN UNC93-like protein MFSD11 OS=Homo sapiens OX=9606 GN=MFSD11 PE=1 SV=2
10	AFDB:Q54DL1	0.493	0.681	1.097E-9	416	0.111	0.159	Q54DL1.pdb.gz	Q54DL1_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292162 PE=4 SV=1
11	AFDB:Q9VS51	0.482	0.520	1.422E-9	546	0.132	0.145	Q9VS51.pdb.gz	Q9VS51_DROME Cln7, isoform A OS=Drosophila melanogaster OX=7227 GN=Cln7 PE=1 SV=2
12	PDB:4ybqB	0.445	0.552	3.534E-7	462	0.094	0.121	4ybqB.pdb.gz
13	PDB:7sptA	0.493	0.606	4.203E-7	470	0.082	0.104	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
14	PDB:6s4mA	0.466	0.628	6.207E-7	426	0.104	0.146	6s4mA.pdb.gz
15	PDB:7aaqA	0.459	0.547	1.044E-6	487	0.097	0.119	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
16	PDB:3o7qA	0.455	0.620	1.090E-6	414	0.099	0.143	3o7qA.pdb.gz
17	PDB:7n98A	0.449	0.544	2.593E-6	473	0.104	0.131	7n98A.pdb.gz
18	PDB:6wbvA	0.427	0.560	3.363E-6	429	0.109	0.152	6wbvA.pdb.gz	Structure of hepcidin-bound ferroportin reveals iron homeostatic mechanisms.
19	PDB:7oixB	0.470	0.604	3.511E-6	451	0.094	0.124	7oixB.pdb.gz	Structural insights into the lysophospholipid brain uptake mechanism and its inhibition by syncytin-2.
20	PDB:4u4tA	0.419	0.534	4.966E-6	444	0.106	0.142	4u4tA.pdb.gz	Structural basis for dynamic mechanism of nitrate/nitrite antiport by NarK

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A8LEX5	0.0	635	627	0.585	0.557	A0A0A8LEX5_SALSA UNC93B1 (Fragment) OS=Salmo salar OX=8030 GN=UNC93B1 PE=2 SV=1
2	F1QYA8	0.0	662	623	0.593	0.568	F1QYA8_DANRE Protein unc-93 homolog B1 OS=Danio rerio OX=7955 GN=UNC93B1 PE=1 SV=1
3	Q8VCW4	0.0	1050	598	0.908	0.906	UN93B_MOUSE Protein unc-93 homolog B1 OS=Mus musculus OX=10090 GN=Unc93b1 PE=1 SV=2
4	Q9H1C4	0.0	1216	597	1.000	1.000	UN93B_HUMAN Protein unc-93 homolog B1 OS=Homo sapiens OX=9606 GN=UNC93B1 PE=1 SV=2
5	Q86WB7	1.11e-23	106	457	0.201	0.263	UN93A_HUMAN Protein unc-93 homolog A OS=Homo sapiens OX=9606 GN=UNC93A PE=1 SV=1
6	Q93380	2.18e-18	91.7	705	0.166	0.140	UNC93_CAEEL Putative potassium channel regulatory protein unc-93 OS=Caenorhabditis elegans OX=6239 GN=unc-93 PE=1 SV=4
7	B7YZU1	2.78e-11	68.6	536	0.161	0.179	B7YZU1_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2121 PE=1 SV=1
8	Q7K3V9	6.36e-11	67.4	522	0.169	0.193	Q7K3V9_DROME GH09628p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2121 PE=1 SV=1
9	Q94AA1	2.95e-04	46.2	464	0.151	0.194	UN933_ARATH UNC93-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At3g09470 PE=2 SV=1
10	Q8WVT3	0.94	35.0	735	0.039	0.031	TPC12_HUMAN Trafficking protein particle complex subunit 12 OS=Homo sapiens OX=9606 GN=TRAPPC12 PE=1 SV=3
11	P01099	7.8	30.8	166	0.039	0.139	PPR1A_RABIT Protein phosphatase 1 regulatory subunit 1A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R1A PE=1 SV=1
12	Q9QUM0	8.0	32.0	1033	0.037	0.021	ITA2B_MOUSE Integrin alpha-IIb OS=Mus musculus OX=10090 GN=Itga2b PE=1 SV=2
13	H2L002	8.5	32.0	1111	0.055	0.030	GCY7_CAEEL Receptor-type guanylate cyclase gcy-7 OS=Caenorhabditis elegans OX=6239 GN=gcy-7 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05978 UNC-93	0.00086	30.2	Ion channel regulatory protein UNC-93

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000227471

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370034	0.995	Toll-like receptor 7
2	9606.ENSP00000417517	0.995	annotation not available
3	9606.ENSP00000296795	0.992	Toll-like receptor 3
4	9606.ENSP00000353874	0.972	Toll-like receptor 9
5	9606.ENSP00000312082	0.960	Toll-like receptor 8
6	9606.ENSP00000361926	0.891	Protein canopy homolog 3
7	9606.ENSP00000401399	0.836	Myeloid differentiation primary response protein MyD88
8	9606.ENSP00000299767	0.822	Endoplasmin
9	9606.ENSP00000478059	0.696	Stromal interaction molecule 1
10	9606.ENSP00000256682	0.693	ADP-ribosylation factor 3
11	9606.ENSP00000358997	0.685	Interleukin-1 receptor-associated kinase 1
12	9606.ENSP00000363089	0.660	Toll-like receptor 4
13	9606.ENSP00000380697	0.655	Interferon regulatory factor 7
14	9606.ENSP00000390651	0.631	Interleukin-1 receptor-associated kinase 4
15	9606.ENSP00000330051	0.616	Major facilitator superfamily domain containing 6 like
16	9606.ENSP00000454207	0.609	TNF receptor-associated factor 3
17	9606.ENSP00000238936	0.604	Transmembrane protein 180
18	9606.ENSP00000329991	0.602	Interferon lambda-1
19	9606.ENSP00000260010	0.597	Toll-like receptor 2
20	9606.ENSP00000258436	0.577	Major facilitator superfamily domain containing 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035325	0.998	Toll-like receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0002221	0.989	pattern recognition receptor signaling pathway
GO:0030522	0.945	intracellular receptor signaling pathway
GO:0002753	0.905	cytosolic pattern recognition receptor signaling pathway
GO:0019222	0.567	regulation of metabolic process
GO:0060255	0.528	regulation of macromolecule metabolic process
GO:0010468	0.431	regulation of gene expression
GO:0009893	0.426	positive regulation of metabolic process
GO:0051239	0.387	regulation of multicellular organismal process
GO:0010604	0.385	positive regulation of macromolecule metabolic process
GO:0001817	0.351	regulation of cytokine production
GO:0048522	0.320	positive regulation of cellular process
GO:0001819	0.318	positive regulation of cytokine production
GO:0009966	0.300	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0012505	0.998	endomembrane system
GO:0031410	0.995	cytoplasmic vesicle
GO:0005768	0.980	endosome
GO:0031090	0.977	organelle membrane
GO:0005783	0.971	endoplasmic reticulum
GO:0098588	0.964	bounding membrane of organelle
GO:0005886	0.894	plasma membrane
GO:0005794	0.792	Golgi apparatus
GO:0005764	0.640	lysosome
GO:0005789	0.538	endoplasmic reticulum membrane
GO:0000139	0.454	Golgi membrane
GO:0012506	0.438	vesicle membrane
GO:0030659	0.431	cytoplasmic vesicle membrane
GO:0010008	0.334	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]