StarFunc result for job id Q9H1D9

User Input

>input (316 residues)
MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSM
GQLDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPL
TEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVL
NQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVELSMEDIETILN
TLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPTGLVRAPCGLCPVFDDCHEGG
EISPSNCIYMTEWLEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H1D9	1.000	1.000	8.845E-57	316	1.000	1.000	Q9H1D9.pdb.gz	RPC6_HUMAN DNA-directed RNA polymerase III subunit RPC6 OS=Homo sapiens OX=9606 GN=POLR3F PE=1 SV=1
2	AFDB:Q6DRK3	0.614	0.617	5.042E-50	314	0.873	0.879	Q6DRK3.pdb.gz
3	AFDB:O94553	0.509	0.533	2.480E-23	301	0.297	0.312	O94553.pdb.gz	RPC6_SCHPO Probable DNA-directed RNA polymerase III subunit rpc6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc6 PE=2 SV=1
4	PDB:7a6hP	0.333	0.698	2.374E-20	146	0.462	1.000	7a6hP.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
5	AFDB:P32910	0.480	0.479	1.609E-18	317	0.231	0.230	P32910.pdb.gz	RPC6_YEAST DNA-directed RNA polymerase III subunit RPC6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC34 PE=1 SV=1
6	AFDB:Q57WC7	0.448	0.402	7.195E-15	355	0.212	0.189	Q57WC7.pdb.gz	Q57WC7_TRYB2 DNA-directed RNA polymerase III subunit RPC6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.480 PE=3 SV=1
7	AFDB:Q9LSZ5	0.458	0.607	1.312E-14	230	0.174	0.239	Q9LSZ5.pdb.gz	Q9LSZ5_ARATH DNA-directed RNA polymerase III subunit RPC6 OS=Arabidopsis thaliana OX=3702 GN=MQM1.2 PE=1 SV=1
8	PDB:6f40P	0.365	0.455	1.821E-10	246	0.199	0.256	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
9	PDB:6tutP	0.410	0.630	1.568E-6	196	0.165	0.265	6tutP.pdb.gz	Structural basis for RNA polymerase III transcription repression by Maf1.
10	PDB:6eu0P	0.357	0.374	9.498E-6	298	0.187	0.198	6eu0P.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
11	AFDB:Q9UST7	0.218	0.068	1.661E-5	1339	0.082	0.019	Q9UST7.pdb.gz	SFC3_SCHPO Transcription factor tau subunit sfc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sfc3 PE=1 SV=1
12	AFDB:Q8K284	0.206	0.045	3.029E-5	2101	0.089	0.013	Q8K284.pdb.gz	TF3C1_MOUSE General transcription factor 3C polypeptide 1 OS=Mus musculus OX=10090 GN=Gtf3c1 PE=1 SV=2
13	AFDB:F1QXK7	0.204	0.165	4.687E-5	448	0.104	0.074	F1QXK7.pdb.gz
14	AFDB:Q5NE10	0.200	0.144	6.503E-5	511	0.104	0.065	Q5NE10.pdb.gz
15	PDB:5afqB	0.210	0.159	9.930E-5	444	0.130	0.092	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
16	PDB:7d58O	0.218	0.152	5.695E-4	490	0.098	0.063	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
17	PDB:3cuqA	0.182	0.256	1.158E-3	219	0.098	0.142	3cuqA.pdb.gz
18	PDB:7z1mO	0.158	0.096	1.440E-3	570	0.130	0.072	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
19	PDB:5lzbz	0.170	0.091	1.792E-3	614	0.076	0.039	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
20	PDB:7a6hO	0.184	0.128	1.792E-3	512	0.117	0.072	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7ZTZ0	0.0	592	314	0.883	0.889	Q7ZTZ0_DANRE DNA-directed RNA polymerase III subunit RPC6 OS=Danio rerio OX=7955 GN=zgc:76983 PE=1 SV=1
2	Q9H1D9	0.0	658	316	1.000	1.000	RPC6_HUMAN DNA-directed RNA polymerase III subunit RPC6 OS=Homo sapiens OX=9606 GN=POLR3F PE=1 SV=1
3	O94553	1.11e-48	166	301	0.297	0.312	RPC6_SCHPO Probable DNA-directed RNA polymerase III subunit rpc6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc6 PE=2 SV=1
4	P32910	1.83e-27	111	317	0.212	0.211	RPC6_YEAST DNA-directed RNA polymerase III subunit RPC6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC34 PE=1 SV=1
5	Q9LSZ5	7.25e-16	77.4	230	0.180	0.248	Q9LSZ5_ARATH DNA-directed RNA polymerase III subunit RPC6 OS=Arabidopsis thaliana OX=3702 GN=MQM1.2 PE=1 SV=1
6	Q57WC7	6.99e-08	55.5	355	0.247	0.220	Q57WC7_TRYB2 DNA-directed RNA polymerase III subunit RPC6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.480 PE=3 SV=1
7	Q9ATB4	0.53	34.3	487	0.047	0.031	TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidopsis thaliana OX=3702 GN=ADA2B PE=1 SV=1
8	F5HDM3	0.77	33.5	284	0.070	0.077	UL23_HCMVM Tegument protein UL23 OS=Human cytomegalovirus (strain Merlin) OX=295027 GN=UL23 PE=3 SV=1
9	A7IAG2	0.94	33.5	325	0.095	0.092	A7IAG2_METB6 Farnesyltranstransferase OS=Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8) OX=456442 GN=Mboo_2209 PE=3 SV=1
10	Q2U6C3	2.9	32.3	4346	0.079	0.006	Q2U6C3_ASPOR Dynein heavy chain, cytoplasmic OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090120000298 PE=4 SV=1
11	P36022	4.3	32.0	4092	0.085	0.007	DYHC_YEAST Dynein heavy chain, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DYN1 PE=1 SV=1
12	Q38AC2	7.1	31.2	2432	0.104	0.014	Q38AC2_TRYB2 Serine/threonine-protein kinase TOR OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2060 PE=3 SV=1
13	F1MUM9	8.4	30.8	1149	0.085	0.023	F1MUM9_BOVIN Adenosine deaminase RNA specific OS=Bos taurus OX=9913 GN=ADAR PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17246 CDC24_OB1	23	16.5	Cell division control protein 24, OB domain 1
2	PF05158 RNA_pol_Rpc34	1.6e-102	355.0	RNA polymerase Rpc34 subunit
3	PF08784 RPA_C	15	17.7	Replication protein A C terminal
4	PF02002 TFIIE_alpha	1.8e+02	13.4	TFIIE alpha subunit
5	PF01978 TrmB	0.96	20.7	Sugar-specific transcriptional regulator TrmB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011925

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000424	0.997	Polymerase (RNA) I polypeptide D, 16kDa
2	61853.ENSNLEP00000004920	0.997	Polymerase (RNA) I polypeptide C, 30kDa
3	61853.ENSNLEP00000006857	0.997	Polymerase (RNA) III (DNA directed) polypeptide C (62kD)
4	61853.ENSNLEP00000008144	0.996	DNA-directed RNA polymerase subunit beta
5	61853.ENSNLEP00000018840	0.996	Polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
6	61853.ENSNLEP00000018858	0.996	Polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)
7	61853.ENSNLEP00000007793	0.995	Uncharacterized protein
8	61853.ENSNLEP00000014728	0.995	Polymerase (RNA) III (DNA directed) polypeptide E (80kD)
9	61853.ENSNLEP00000001458	0.994	Polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
10	61853.ENSNLEP00000001712	0.994	CGRP receptor component
11	61853.ENSNLEP00000009687	0.994	DNA-directed RNA polymerase subunit
12	61853.ENSNLEP00000012786	0.994	DNA-directed RNA polymerase subunit
13	61853.ENSNLEP00000018225	0.990	Polymerase (RNA) II (DNA directed) polypeptide F
14	61853.ENSNLEP00000016678	0.989	Polymerase (RNA) III (DNA directed) polypeptide G (32kD)
15	61853.ENSNLEP00000007027	0.974	Polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like
16	61853.ENSNLEP00000010593	0.963	Polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
17	61853.ENSNLEP00000019980	0.963	BRF1, RNA polymerase III transcription initiation factor 90 kDa subunit
18	61853.ENSNLEP00000014792	0.960	BRF2, RNA polymerase III transcription initiation factor 50 kDa subunit
19	61853.ENSNLEP00000002049	0.956	DNA-directed RNA polymerase subunit beta
20	61853.ENSNLEP00000003627	0.942	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003690	1.000	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.919	biological regulation
GO:0050789	0.912	regulation of biological process
GO:0019222	0.819	regulation of metabolic process
GO:0048518	0.804	positive regulation of biological process
GO:0060255	0.797	regulation of macromolecule metabolic process
GO:0010468	0.782	regulation of gene expression
GO:0009893	0.719	positive regulation of metabolic process
GO:0009987	0.701	cellular process
GO:0002831	0.676	regulation of response to biotic stimulus
GO:0032479	0.664	regulation of type I interferon production
GO:0032648	0.648	regulation of interferon-beta production
GO:0010604	0.635	positive regulation of macromolecule metabolic process
GO:0001819	0.601	positive regulation of cytokine production
GO:0071704	0.505	organic substance metabolic process
GO:0002833	0.482	positive regulation of response to biotic stimulus
GO:0044237	0.481	cellular metabolic process
GO:0032101	0.477	regulation of response to external stimulus
GO:0006807	0.473	nitrogen compound metabolic process
GO:0043170	0.462	macromolecule metabolic process
GO:0080134	0.461	regulation of response to stress
GO:0034641	0.461	cellular nitrogen compound metabolic process
GO:0046483	0.460	heterocycle metabolic process
GO:0044238	0.454	primary metabolic process
GO:0006139	0.437	nucleobase-containing compound metabolic process
GO:0032481	0.366	positive regulation of type I interferon production
GO:0031347	0.348	regulation of defense response
GO:0050794	0.316	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0005666	0.995	RNA polymerase III complex
GO:0043232	0.671	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]