StarFunc result for job id Q9H1H9

User Input

>input (1805 residues)
MSDTKVKVAVRVRPMNRRELELNTKCVVEMEGNQTVLHPPPSNTKQGERKPPKVFAFDYC
FWSMDESNTTKYAGQEVVFKCLGEGILEKAFQGYNACIFAYGQTGSGKSFSMMGHAEQLG
LIPRLCCALFKRISLEQNESQTFKVEVSYMEIYNEKVRDLLDPKGSRQSLKVREHKVLGP
YVDGLSQLAVTSFEDIESLMSEGNKSRTVAATNMNEESSRSHAVFNIIITQTLYDLQSGN
SGEKVSKVSLVDLAGSERVSKTGAAGERLKEGSNINKSLTTLGLVISSLADQAAGKGKSK
FVPYRDSVLTWLLKDNLGGNSQTSMIATISPAADNYEETLSTLRYADRAKRIVNHAVVNE
DPNAKVIRELREEVEKLREQLSQAEAMKAPELKEKLEESEKLIKELTVTWEEKLRKTEEI
AQERQRQLESMGISLEMSGIKVGDDKCYLVNLNADPALNELLVYYLKDHTRVGADTSQDI
QLFGIGIQPQHCEIDIASDGDVTLTPKENARSCVNGTLVCSTTQLWHGDRILWGNNHFFR
INLPKRKRRDWLKDFEKETGPPEHDLDAASEASSEPDYNYEFAQMEVIMKTLNSNDPVQN
VVQVLEKQYLEEKRSALEEQRLMYERELEQLRQQLSPDRQPQSSGPDRLAYSSQTAQQKV
TQWAEERDELFRQSLAKLREQLVKANTLVREANFLAEEMSKLTDYQVTLQIPAANLSANR
KRGAIVSEPAIQVRRKGKSTQVWTIEKLENKLIDMRDLYQEWKEKVPEAKRLYGKRGDPF
YEAQENHNLIGVANVFLECLFCDVKLQYAVPIISQQGEVAGRLHVEVMRVTGAVPERVVE
DDSSENSSESGSLEVVDSSGEIIHRVKKLTCRVKIKEATGLPLNLSNFVFCQYTFWDQCE
STVAAPVVDPEVPSPQSKDAQYTVTFSHCKDYVVNVTEEFLEFISDGALAIEVWGHRCAG
NGSSIWEVDSLHAKTRTLHDRWNEVTRRIEMWISILELNELGEYAAVELHQAKDVNTGGI
FQLRQGHSRRVQVTVKPVQHSGTLPLMVEAILSVSIGCVTARSTKLQRGLDSYQRDDEDG
DDMDSYQEEDLNCVRERWSDALIKRREYLDEQIKKVSNKTEKTEDDVEREAQLVEQWVGL
TEERNAVLVPAPGSGIPGAPADWIPPPGMETHIPVLFLDLNADDLSANEQLVGPHASGVN
SILPKEHGSQFFYLPIIKHSDDEVSATASWDSSVHDSVHLNRVTPQNERIYLIVKTTVQL
SHPAAMELVLRKRIAANIYNKQSFTQSLKRRISLKNIFYSCGVTYEIVSNIPKATEEIED
RETLALLAARSENEGTSDGETYIEKYTRGVLQVENILSLERLRQAVTVKEALSTKARHIR
RSLSTPNVHNVSSSRPDLSGFDEDDKGWPENQLDMSDYSSSYQDVACYGTLPRDSPRRNK
EGCTSETPHALTVSPFKAFSPQPPKFFKPLMPVKEEHKKRIALEARPLLSQESMPPPQAH
NPGCIVPSGSNGSSMPVEHNSKREKKIDSEEEENELEAINRKLISSQPYVPVEFADFSVY
NASLENREWFSSKVDLSNSRVLEKEVSRSPTTSSITSGYFSHSASNATLSDMVVPSSDSS
DQLAIQTKDADSTEHSTPSLVHDFRPSSNKELTEVEKGLVKDKIIVVPLKENSALAKGSP
SSQSIPEKNSKSLCRTGSCSELDACPSKISQPARGFCPREVTVEHTTNILEDHSFTEFMG
VSEGKDFDGLTDSSAGELSSRRSLPNKTGGKTVSDGLHHPSQLHSKLENDQVIIPEAAFW
VLCCQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K8Z9	0.516	0.506	0.000	1843	0.541	0.530	A0A0G2K8Z9.pdb.gz	A0A0G2K8Z9_RAT Kinesin family member 13B OS=Rattus norvegicus OX=10116 GN=Kif13b PE=1 SV=2
2	AFDB:Q9EQW7	0.755	0.778	0.000	1749	0.892	0.921	Q9EQW7.pdb.gz	KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus OX=10090 GN=Kif13a PE=1 SV=1
3	AFDB:Q9H1H9	1.000	1.000	0.000	1805	1.000	1.000	Q9H1H9.pdb.gz	KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens OX=9606 GN=KIF13A PE=1 SV=2
4	AFDB:Q9NQT8	0.394	0.390	0.000	1826	0.553	0.547	Q9NQT8.pdb.gz	KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2
5	PDB:7wrgA	0.256	0.529	2.946E-63	812	0.169	0.376	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
6	PDB:7wrgB	0.247	0.529	1.517E-61	783	0.166	0.383	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
7	PDB:4h1gA	0.155	0.404	2.617E-22	670	0.060	0.163	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
8	AFDB:Q9ULI4	0.169	0.162	7.741E-18	1882	0.148	0.142	Q9ULI4.pdb.gz	KI26A_HUMAN Kinesin-like protein KIF26A OS=Homo sapiens OX=9606 GN=KIF26A PE=1 SV=3
9	AFDB:Q52KG5	0.170	0.164	1.585E-17	1881	0.156	0.150	Q52KG5.pdb.gz	KI26A_MOUSE Kinesin-like protein KIF26A OS=Mus musculus OX=10090 GN=Kif26a PE=1 SV=2
10	PDB:2ff4A	0.049	0.227	3.792E-7	379	0.029	0.140	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
11	PDB:7dvqX	0.050	0.530	7.390E-5	156	0.011	0.122	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:2kb3A	0.051	0.558	2.165E-4	143	0.013	0.161	2kb3A.pdb.gz
13	AFDB:B2RXR7	0.032	0.045	7.450E-3	1161	0.040	0.063	B2RXR7.pdb.gz	B2RXR7_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
14	PDB:6wskA	0.062	0.294	1.368E-2	287	0.018	0.115	6wskA.pdb.gz
15	PDB:5z56X	0.051	0.520	1.516E-2	159	0.008	0.088	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
16	AFDB:Q6IS19	0.032	0.049	9.150E-2	1026	0.042	0.074	Q6IS19.pdb.gz
17	AFDB:P93750	0.025	0.035	1.450E-1	1215	0.057	0.085	P93750.pdb.gz	P93750_ARATH Uncharacterized protein At2g41960 OS=Arabidopsis thaliana OX=3702 GN=At2g41960 PE=1 SV=1
18	PDB:6wgeA	0.031	0.083	1.597E-1	390	0.020	0.092	6wgeA.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
19	AFDB:Q8IZD9	0.030	0.028	2.420E-1	2030	0.050	0.044	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
20	PDB:5ye5A	0.035	0.099	2.804E-1	464	0.012	0.045	5ye5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KFR5	1600	1957	0.457	0.421	A0A0B4KFR5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
2	A0A0B4KG24	1555	1908	0.445	0.421	A0A0B4KG24_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
3	A0A0B4LGK5	1598	1913	0.457	0.431	A0A0B4LGK5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
4	A0A0G2K8Z9	1771	1815	0.516	0.513	A0A0G2K8Z9_RAT Kinesin family member 13B OS=Rattus norvegicus OX=10116 GN=Kif13b PE=1 SV=2
5	A0A8I6A6V5	629	1697	0.219	0.233	A0A8I6A6V5_RAT Kinesin family member 1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=1
6	A1ZA18	1598	1921	0.457	0.429	A1ZA18_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
7	A1ZAJ2	638	1670	0.247	0.267	KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1
8	A4UZI0	1600	1899	0.457	0.434	A4UZI0_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
9	E9Q4K7	1864	1843	0.536	0.525	E9Q4K7_MOUSE Kinesin family member 13B OS=Mus musculus OX=10090 GN=Kif13b PE=1 SV=1
10	E9QDE5	613	1763	0.208	0.213	E9QDE5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
11	F1M4A4	625	1707	0.219	0.232	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
12	F1QBV5	613	1770	0.208	0.212	F1QBV5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
13	O01349	1596	1921	0.457	0.429	O01349_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=2 SV=1
14	P23678	621	1584	0.238	0.271	UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=unc-104 PE=1 SV=4
15	P33173	627	1695	0.219	0.234	KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus OX=10090 GN=Kif1a PE=1 SV=2
16	Q12756	629	1690	0.219	0.234	KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens OX=9606 GN=KIF1A PE=1 SV=2
17	Q20888	1233	1561	0.383	0.443	Q20888_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=klp-4 PE=1 SV=3
18	Q8MQ20	1233	1576	0.383	0.438	Q8MQ20_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=klp-4 PE=1 SV=2
19	Q9EQW7	3219	1749	0.893	0.921	KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus OX=10090 GN=Kif13a PE=1 SV=1
20	Q9H1H9	3744	1805	1.000	1.000	KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens OX=9606 GN=KIF13A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12473 DUF3694	5.6e-23	93.5	Kinesin protein
2	PF00350 Dynamin_N	7e+02	11.7	Dynamin family
3	PF00498 FHA	0.052	25.2	FHA domain
4	PF12423 KIF1B	3.7e-14	64.0	Kinesin protein 1B
5	PF00225 Kinesin	1.4e-110	380.9	Kinesin motor domain
6	PF16183 Kinesin_assoc	1.5e-22	92.2	Kinesin-associated
7	PF03037 KMP11	2.5e+02	13.8	Kinetoplastid membrane protein 11
8	PF16796 Microtub_bd	8.2e-19	79.5	Microtubule binding
9	PF16697 Yop-YscD_cpl	1.6	20.4	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259711

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350199	0.928	AP-1 complex subunit beta-1
2	9606.ENSP00000261890	0.916	Ras-related protein Rab-11A
3	9606.ENSP00000000412	0.722	Cation-dependent mannose-6-phosphate receptor
4	9606.ENSP00000405111	0.716	Putative ATP-dependent RNA helicase DHX57
5	9606.ENSP00000354376	0.708	Ras-related protein Rab-25
6	9606.ENSP00000251119	0.695	Zinc finger FYVE domain-containing protein 26
7	9606.ENSP00000365530	0.685	Syntaxin-binding protein 4
8	9606.ENSP00000417038	0.680	Phosphatase and actin regulator 2
9	9606.ENSP00000367197	0.676	Secretagogin, EF-hand calcium binding protein
10	9606.ENSP00000311219	0.666	Tripartite motif-containing protein 59
11	9606.ENSP00000344844	0.665	Hepatitis A virus cellular receptor 1
12	9606.ENSP00000261647	0.658	Tetratricopeptide repeat protein 19, mitochondrial
13	9606.ENSP00000444029	0.650	Nuclear pore complex protein Nup153
14	9606.ENSP00000345731	0.647	Disks large homolog 1
15	9606.ENSP00000345464	0.641	E3 ubiquitin-protein ligase NHLRC1
16	9606.ENSP00000398824	0.619	PHD finger protein 21A
17	9606.ENSP00000456405	0.615	Target of rapamycin complex subunit LST8
18	9606.ENSP00000286788	0.612	T-complex protein 1 subunit theta
19	9606.ENSP00000258091	0.600	T-complex protein 1 subunit eta
20	9606.ENSP00000275603	0.600	T-complex protein 1 subunit zeta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003774	0.989	cytoskeletal motor activity
GO:0140657	0.984	ATP-dependent activity
GO:0003777	0.970	microtubule motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0008150	1.000	biological_process
GO:0051649	0.991	establishment of localization in cell
GO:0006810	0.931	transport
GO:0065007	0.903	biological regulation
GO:0050794	0.878	regulation of cellular process
GO:0046907	0.875	intracellular transport
GO:0033036	0.845	macromolecule localization
GO:0007017	0.768	microtubule-based process
GO:0071840	0.708	cellular component organization or biogenesis
GO:0016043	0.696	cellular component organization
GO:0070727	0.691	cellular macromolecule localization
GO:0016192	0.686	vesicle-mediated transport
GO:0008104	0.682	protein localization
GO:0045184	0.602	establishment of protein localization
GO:0006996	0.567	organelle organization
GO:0015031	0.429	protein transport
GO:0007018	0.423	microtubule-based movement
GO:0051640	0.419	organelle localization
GO:0051656	0.359	establishment of organelle localization
GO:0048518	0.348	positive regulation of biological process
GO:0048522	0.314	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0016020	0.990	membrane
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0005829	0.950	cytosol
GO:0031090	0.932	organelle membrane
GO:0031982	0.854	vesicle
GO:0031410	0.839	cytoplasmic vesicle
GO:0015630	0.797	microtubule cytoskeleton
GO:0005768	0.700	endosome
GO:0098588	0.663	bounding membrane of organelle
GO:0012506	0.514	vesicle membrane
GO:0030659	0.483	cytoplasmic vesicle membrane
GO:0099080	0.419	supramolecular complex
GO:0032991	0.378	protein-containing complex
GO:0031984	0.338	organelle subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]