StarFunc result for job id Q9H1J1

User Input

>input (476 residues)
MRSEKEGAGGLRAAVAARGPSGREKLSALEVQFHRDSQQQEAETPPTSSSGCGGGAGKPR
EEKRTALSKVVIRRLPPGLTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINFRN
PDDILLFRDRFDGYIFLDSKGLEYPAVVEFAPFQKIAKKKLRKKDAKTGSIEDDPEYKKF
LETYCVEEEKTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLEKQRIREEKREERR
RRELEKKRLREEEKRRRREEERCKKKETDKQKKIAEKEVRIKLLKKPEKGEEPTTEKPKE
RGEEIDTGGGKQESCAPGAVVKARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQR
YHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPGEAMERLGRAQRC
DDSPAPRKERLANKDRPALQLYDPGARFRARECGGNRRICKAEGSGTGPEKREEAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H1J1	1.000	1.000	2.174E-74	476	1.000	1.000	Q9H1J1.pdb.gz	REN3A_HUMAN Regulator of nonsense transcripts 3A OS=Homo sapiens OX=9606 GN=UPF3A PE=1 SV=1
2	AFDB:Q3ULJ3	0.461	0.515	5.864E-46	422	0.622	0.701	Q3ULJ3.pdb.gz	Q3ULJ3_MOUSE UPF3 regulator of nonsense transcripts homolog A (Yeast) OS=Mus musculus OX=10090 GN=Upf3a PE=1 SV=1
3	AFDB:B0S733	0.268	0.281	5.187E-40	452	0.521	0.549	B0S733.pdb.gz	REN3A_DANRE Regulator of nonsense transcripts 3A OS=Danio rerio OX=7955 GN=upf3a PE=1 SV=2
4	AFDB:F1QNX7	0.251	0.256	7.603E-30	467	0.437	0.445	F1QNX7.pdb.gz	REN3B_DANRE Regulator of nonsense transcripts 3B OS=Danio rerio OX=7955 GN=upf3b PE=2 SV=1
5	AFDB:Q7YU08	0.155	0.089	1.536E-6	865	0.120	0.066	Q7YU08.pdb.gz	Q7YU08_DROME LD15974p OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=2 SV=1
6	AFDB:Q9XYZ6	0.163	0.124	7.684E-5	653	0.099	0.072	Q9XYZ6.pdb.gz	Q9XYZ6_DROME Peptidyl-prolyl cis-trans isomerase OS=Drosophila melanogaster OX=7227 GN=UKL PE=2 SV=1
7	PDB:7dvqY	0.151	0.458	1.206E-4	140	0.034	0.114	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
8	PDB:5vsuA	0.144	0.175	3.207E-4	387	0.025	0.031	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
9	PDB:6qx91K	0.150	0.327	3.423E-4	201	0.027	0.065	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
10	PDB:3lqvB	0.148	0.532	4.163E-4	115	0.042	0.174	3lqvB.pdb.gz	Branch Recognition by SF3b14
11	AFDB:Q53KW9	0.110	0.070	4.186E-4	803	0.162	0.096	Q53KW9.pdb.gz	AM1_ORYSJ Protein AMEIOTIC 1 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=AM1 PE=1 SV=1
12	PDB:6g90B	0.149	0.335	1.346E-3	193	0.032	0.078	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
13	PDB:6gd1A	0.143	0.339	1.437E-3	190	0.025	0.063	6gd1A.pdb.gz
14	PDB:7dvqI	0.153	0.507	1.637E-3	128	0.053	0.195	7dvqI.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:1hl6A	0.150	0.527	1.747E-3	119	0.015	0.059	1hl6A.pdb.gz
16	PDB:6ff7X	0.141	0.360	1.747E-3	171	0.025	0.070	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:5xjcw	0.152	0.670	2.268E-3	91	0.021	0.110	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
18	AFDB:Q01617	0.191	0.152	3.160E-3	606	0.050	0.040	Q01617.pdb.gz	CPO_DROME Protein couch potato OS=Drosophila melanogaster OX=7227 GN=cpo PE=2 SV=4
19	AFDB:Q53GL6	0.148	0.222	6.066E-3	307	0.097	0.150	Q53GL6.pdb.gz	Q53GL6_HUMAN RNA binding protein (Autoantigenic, hnRNP-associated with lethal yellow) long isoform variant (Fragment) OS=Homo sapiens OX=9606 GN=RALY PE=1 SV=1
20	AFDB:Q9BWT7	0.078	0.052	7.873E-3	1032	0.113	0.052	Q9BWT7.pdb.gz	CAR10_HUMAN Caspase recruitment domain-containing protein 10 OS=Homo sapiens OX=9606 GN=CARD10 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H1J1	0.0	947	476	1.000	1.000	REN3A_HUMAN Regulator of nonsense transcripts 3A OS=Homo sapiens OX=9606 GN=UPF3A PE=1 SV=1
2	Q3ULJ3	6.71e-153	443	422	0.611	0.690	Q3ULJ3_MOUSE UPF3 regulator of nonsense transcripts homolog A (Yeast) OS=Mus musculus OX=10090 GN=Upf3a PE=1 SV=1
3	Q9CUH6	5.73e-109	325	248	0.363	0.698	Q9CUH6_MOUSE UPF3 domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Upf3a PE=2 SV=1
4	B0S733	6.17e-104	319	452	0.546	0.575	REN3A_DANRE Regulator of nonsense transcripts 3A OS=Danio rerio OX=7955 GN=upf3a PE=1 SV=2
5	Q9CS15	4.85e-80	250	232	0.258	0.530	Q9CS15_MOUSE UPF3 domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Upf3b PE=2 SV=1
6	Q3ULL6	8.21e-79	255	472	0.307	0.309	Q3ULL6_MOUSE UPF3 regulator of nonsense transcripts homolog B (yeast) OS=Mus musculus OX=10090 GN=Upf3b PE=1 SV=1
7	Q9BZI7	1.19e-75	247	483	0.242	0.238	REN3B_HUMAN Regulator of nonsense transcripts 3B OS=Homo sapiens OX=9606 GN=UPF3B PE=1 SV=1
8	F1QNX7	6.07e-71	234	467	0.324	0.330	REN3B_DANRE Regulator of nonsense transcripts 3B OS=Danio rerio OX=7955 GN=upf3b PE=2 SV=1
9	Q9CTQ4	1.46e-70	223	155	0.229	0.703	Q9CTQ4_MOUSE UPF3 domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Upf3a PE=2 SV=1
10	Q80UI8	5.64e-53	185	388	0.229	0.281	Q80UI8_MOUSE Upf3b protein (Fragment) OS=Mus musculus OX=10090 GN=Upf3b PE=2 SV=1
11	Q9W1H3	5.66e-34	135	492	0.141	0.136	Q9W1H3_DROME FI21285p1 OS=Drosophila melanogaster OX=7227 GN=Upf3 PE=1 SV=2
12	Q149I6	1.36e-32	126	248	0.124	0.238	Q149I6_MOUSE Upf3b protein OS=Mus musculus OX=10090 GN=Upf3b PE=2 SV=1
13	F6Q8N5	2.96e-26	109	260	0.116	0.212	F6Q8N5_MOUSE UPF3 regulator of nonsense transcripts homolog B (yeast) (Fragment) OS=Mus musculus OX=10090 GN=Upf3b PE=1 SV=1
14	Q9FVW4	3.38e-22	101	482	0.120	0.118	RENT3_ARATH Regulator of nonsense transcripts UPF3 OS=Arabidopsis thaliana OX=3702 GN=UPF3 PE=1 SV=1
15	Q8WQF3	1.65e-17	86.3	368	0.179	0.231	Q8WQF3_CAEEL UPF3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-4 PE=1 SV=2
16	Q20445	1.69e-17	85.5	329	0.179	0.258	Q20445_CAEEL UPF3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-4 PE=1 SV=2
17	Q10267	1.36e-10	64.3	278	0.099	0.169	UPF3_SCHPO Nonsense-mediated mRNA decay protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf3 PE=3 SV=1
18	Q8I4Z1	0.001	44.3	1846	0.074	0.019	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1
19	Q8IDX6	0.008	41.6	3130	0.080	0.012	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
20	Q8K1N2	0.049	38.9	1249	0.069	0.026	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03467 Smg4_UPF3	1.4e-47	173.5	Smg-4/UPF3 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364448

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348708	0.999	Regulator of nonsense transcripts 2
2	9606.ENSP00000402515	0.999	Serine/threonine-protein kinase SMG1
3	9606.ENSP00000470142	0.999	Regulator of nonsense transcripts 1
4	9606.ENSP00000269349	0.982	Eukaryotic initiation factor 4A-III
5	9606.ENSP00000463058	0.980	RNA-binding protein 8A
6	9606.ENSP00000319240	0.979	Protein mago nashi homolog 2
7	9606.ENSP00000360525	0.978	Protein mago nashi homolog
8	9606.ENSP00000264645	0.965	Protein CASC3
9	9606.ENSP00000457723	0.965	RNA-binding protein with serine-rich domain 1
10	9606.ENSP00000436679	0.961	Nuclear RNA export factor 1
11	9606.ENSP00000355261	0.939	Protein SMG5
12	9606.ENSP00000425133	0.929	Protein SMG7
13	9606.ENSP00000263073	0.924	Telomerase-binding protein EST1A
14	9606.ENSP00000276201	0.882	Regulator of nonsense transcripts 3B
15	9606.ENSP00000270066	0.881	Protein SMG9
16	9606.ENSP00000386156	0.854	Partner of Y14 and mago
17	9606.ENSP00000438748	0.846	Protein SMG8
18	9606.ENSP00000264951	0.843	5'-3' exoribonuclease 1
19	9606.ENSP00000421592	0.828	THO complex subunit 4
20	9606.ENSP00000378504	0.820	Nuclear RNA export factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042162	1.000	telomeric DNA binding
GO:0003729	0.999	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0010468	0.990	regulation of gene expression
GO:0080090	0.986	regulation of primary metabolic process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0048518	0.975	positive regulation of biological process
GO:0010628	0.973	positive regulation of gene expression
GO:0010556	0.920	regulation of macromolecule biosynthetic process
GO:0031326	0.918	regulation of cellular biosynthetic process
GO:0048522	0.901	positive regulation of cellular process
GO:0010608	0.876	post-transcriptional regulation of gene expression
GO:0051246	0.875	regulation of protein metabolic process
GO:0071704	0.872	organic substance metabolic process
GO:0006417	0.870	regulation of translation
GO:0044237	0.864	cellular metabolic process
GO:0031325	0.854	positive regulation of cellular metabolic process
GO:0051173	0.841	positive regulation of nitrogen compound metabolic process
GO:0043170	0.825	macromolecule metabolic process
GO:0044238	0.812	primary metabolic process
GO:0006807	0.796	nitrogen compound metabolic process
GO:0034641	0.770	cellular nitrogen compound metabolic process
GO:0046483	0.717	heterocycle metabolic process
GO:1901360	0.716	organic cyclic compound metabolic process
GO:0006725	0.716	cellular aromatic compound metabolic process
GO:0006139	0.714	nucleobase-containing compound metabolic process
GO:0045727	0.701	positive regulation of translation
GO:0016070	0.695	RNA metabolic process
GO:0048519	0.688	negative regulation of biological process
GO:0009892	0.580	negative regulation of metabolic process
GO:0010605	0.570	negative regulation of macromolecule metabolic process
GO:0044260	0.558	cellular macromolecule metabolic process
GO:0016071	0.469	mRNA metabolic process
GO:0019219	0.433	regulation of nucleobase-containing compound metabolic process
GO:0006401	0.429	RNA catabolic process
GO:0051252	0.400	regulation of RNA metabolic process
GO:0000956	0.369	nuclear-transcribed mRNA catabolic process
GO:1903311	0.353	regulation of mRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0005829	0.992	cytosol
GO:0140513	0.981	nuclear protein-containing complex
GO:0035145	0.936	exon-exon junction complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]