StarFunc result for job id Q9H1J7

User Input

>input (359 residues)
MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAV
SAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYICK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1WBR9	0.977	0.943	1.054E-61	372	0.942	0.909	B1WBR9.pdb.gz	B1WBR9_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt5b PE=3 SV=1
2	AFDB:Q3L255	0.934	0.934	1.282E-55	359	0.844	0.844	Q3L255.pdb.gz	Q3L255_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5b PE=2 SV=1
3	AFDB:Q92050	0.965	0.954	1.648E-55	363	0.802	0.793	Q92050.pdb.gz	WNT5B_DANRE Protein Wnt-5b OS=Danio rerio OX=7955 GN=wnt5b PE=2 SV=1
4	AFDB:P31286	0.964	0.911	3.870E-55	380	0.769	0.726	P31286.pdb.gz	WNT5A_XENLA Protein Wnt-5a OS=Xenopus laevis OX=8355 GN=wnt5a PE=2 SV=2
5	AFDB:P22725	0.955	0.904	4.500E-55	380	0.805	0.761	P22725.pdb.gz	WNT5A_MOUSE Protein Wnt-5a OS=Mus musculus OX=10090 GN=Wnt5a PE=1 SV=2
6	AFDB:Q9YGX6	0.955	0.892	1.186E-52	385	0.783	0.730	Q9YGX6.pdb.gz	Q9YGX6_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5A PE=2 SV=1
7	AFDB:A1BPR0	0.957	0.920	5.627E-52	374	0.719	0.690	A1BPR0.pdb.gz	A1BPR0_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt5a PE=2 SV=1
8	AFDB:P34889	0.889	0.886	2.946E-38	360	0.448	0.447	P34889.pdb.gz	WNT2_CAEEL Protein Wnt-2 OS=Caenorhabditis elegans OX=6239 GN=cwn-2 PE=1 SV=2
9	AFDB:Q98SN7	0.850	0.795	5.997E-37	385	0.499	0.465	Q98SN7.pdb.gz	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
10	AFDB:P27467	0.853	0.870	1.211E-36	352	0.435	0.443	P27467.pdb.gz	WNT3A_MOUSE Protein Wnt-3a OS=Mus musculus OX=10090 GN=Wnt3a PE=1 SV=1
11	PDB:6ahyB	0.741	0.843	1.680E-30	313	0.401	0.460	6ahyB.pdb.gz
12	PDB:4f0aB	0.660	0.792	1.438E-24	294	0.337	0.412	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:7l1kB	0.136	0.085	1.214	660	0.075	0.041	7l1kB.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.
14	PDB:1rqiA	0.190	0.215	1.641	300	0.067	0.080	1rqiA.pdb.gz	Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
15	PDB:6sb3A	0.056	0.037	1.726	604	0.008	0.005	6sb3A.pdb.gz
16	PDB:7mq8NH	0.102	0.049	2.007	1066	0.114	0.038	7mq8NH.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:4w8yA	0.165	0.080	2.453	835	0.045	0.019	4w8yA.pdb.gz	Structural Model of a CRISPR RNA-Silencing Complex Reveals the RNA-Target Cleavage Activity in Cmr4.
18	PDB:7e9gR	0.101	0.058	2.453	769	0.067	0.031	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
19	PDB:4gbyA	0.101	0.079	2.579	475	0.084	0.063	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
20	PDB:7a9wA	0.130	0.102	2.852	513	0.058	0.041	7a9wA.pdb.gz	The pentatricopeptide repeat protein Rmd9 recognizes the dodecameric element in the 3'-UTRs of yeast mitochondrial mRNAs.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1BPR0	0.0	558	374	0.719	0.690	A1BPR0_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt5a PE=2 SV=1
2	B1WBR9	0.0	696	372	0.942	0.909	B1WBR9_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt5b PE=3 SV=1
3	P22725	0.0	624	380	0.805	0.761	WNT5A_MOUSE Protein Wnt-5a OS=Mus musculus OX=10090 GN=Wnt5a PE=1 SV=2
4	P22726	0.0	696	359	0.942	0.942	WNT5B_MOUSE Protein Wnt-5b OS=Mus musculus OX=10090 GN=Wnt5b PE=1 SV=2
5	P31286	0.0	588	380	0.747	0.705	WNT5A_XENLA Protein Wnt-5a OS=Xenopus laevis OX=8355 GN=wnt5a PE=2 SV=2
6	P41221	0.0	625	380	0.805	0.761	WNT5A_HUMAN Protein Wnt-5a OS=Homo sapiens OX=9606 GN=WNT5A PE=1 SV=2
7	Q3L255	0.0	657	359	0.844	0.844	Q3L255_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5b PE=2 SV=1
8	Q92050	0.0	627	363	0.802	0.793	WNT5B_DANRE Protein Wnt-5b OS=Danio rerio OX=7955 GN=wnt5b PE=2 SV=1
9	Q9H1J7	0.0	748	359	1.000	1.000	WNT5B_HUMAN Protein Wnt-5b OS=Homo sapiens OX=9606 GN=WNT5B PE=2 SV=2
10	Q9QXQ7	0.0	622	380	0.805	0.761	WNT5A_RAT Protein Wnt-5a OS=Rattus norvegicus OX=10116 GN=Wnt5a PE=2 SV=2
11	Q9YGX6	0.0	609	385	0.783	0.730	Q9YGX6_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5A PE=2 SV=1
12	Q98SN7	1.42e-121	357	385	0.501	0.468	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
13	Q93097	6.90e-117	346	391	0.476	0.437	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
14	Q8AY89	7.53e-117	345	387	0.476	0.442	Q8AY89_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2b PE=2 SV=1
15	A0A0G2K3B7	1.51e-116	343	353	0.485	0.493	A0A0G2K3B7_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=3 SV=1
16	O70283	2.26e-116	344	389	0.474	0.437	WNT2B_MOUSE Protein Wnt-2b OS=Mus musculus OX=10090 GN=Wnt2b PE=2 SV=3
17	Q1L130	2.75e-116	344	396	0.471	0.427	Q1L130_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2bb PE=2 SV=1
18	P28047	3.21e-114	337	349	0.451	0.464	WNT7B_MOUSE Protein Wnt-7b OS=Mus musculus OX=10090 GN=Wnt7b PE=1 SV=1
19	Q5NSW6	3.21e-114	337	349	0.451	0.464	Q5NSW6_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=2 SV=1
20	P34889	6.75e-114	337	360	0.437	0.436	WNT2_CAEEL Protein Wnt-2 OS=Caenorhabditis elegans OX=6239 GN=cwn-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	4.7e-118	405.8	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322304	0.971	Protein-serine O-palmitoleoyltransferase porcupine
2	9606.ENSP00000478721	0.969	Tyrosine-protein kinase RYK
3	9606.ENSP00000323901	0.946	Frizzled-2
4	9606.ENSP00000363826	0.944	Frizzled-8
5	9606.ENSP00000437489	0.928	Frizzled-3
6	9606.ENSP00000272164	0.923	Protein Wnt-9a
7	9606.ENSP00000264634	0.922	Protein Wnt-5a
8	9606.ENSP00000290015	0.922	Protein Wnt-9b
9	9606.ENSP00000340677	0.918	Protein Wnt-8b
10	9606.ENSP00000426653	0.918	Protein Wnt-8a
11	9606.ENSP00000261349	0.913	Low-density lipoprotein receptor-related protein 6
12	9606.ENSP00000293549	0.910	Proto-oncogene Wnt-1
13	9606.ENSP00000345785	0.910	Frizzled-9
14	9606.ENSP00000301061	0.909	Protein Wnt-10b
15	9606.ENSP00000351605	0.908	Frizzled-6
16	9606.ENSP00000233948	0.907	Protein Wnt-6
17	9606.ENSP00000258411	0.907	Protein Wnt-10a
18	9606.ENSP00000265441	0.907	Protein Wnt-2
19	9606.ENSP00000286201	0.907	Frizzled-7
20	9606.ENSP00000325526	0.907	Protein Wnt-11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0048018	0.969	receptor ligand activity
GO:0005109	0.811	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.996	anatomical structure development
GO:0009987	0.991	cellular process
GO:0050896	0.988	response to stimulus
GO:0007275	0.985	multicellular organism development
GO:0048522	0.985	positive regulation of cellular process
GO:0048731	0.974	system development
GO:0023052	0.967	signaling
GO:0051716	0.963	cellular response to stimulus
GO:0007154	0.934	cell communication
GO:0048513	0.931	animal organ development
GO:0048583	0.926	regulation of response to stimulus
GO:0009888	0.914	tissue development
GO:0007165	0.909	signal transduction
GO:0030154	0.892	cell differentiation
GO:0048519	0.758	negative regulation of biological process
GO:0023051	0.750	regulation of signaling
GO:0019222	0.750	regulation of metabolic process
GO:0010646	0.750	regulation of cell communication
GO:0048523	0.738	negative regulation of cellular process
GO:0060255	0.735	regulation of macromolecule metabolic process
GO:0009966	0.733	regulation of signal transduction
GO:0007267	0.722	cell-cell signaling
GO:0009653	0.701	anatomical structure morphogenesis
GO:0007166	0.650	cell surface receptor signaling pathway
GO:0051171	0.640	regulation of nitrogen compound metabolic process
GO:1905114	0.622	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0016055	0.607	Wnt signaling pathway
GO:0061448	0.592	connective tissue development
GO:0010468	0.545	regulation of gene expression
GO:0009893	0.526	positive regulation of metabolic process
GO:0010604	0.512	positive regulation of macromolecule metabolic process
GO:0031323	0.506	regulation of cellular metabolic process
GO:0050793	0.505	regulation of developmental process
GO:0080090	0.499	regulation of primary metabolic process
GO:0048584	0.433	positive regulation of response to stimulus
GO:0023056	0.402	positive regulation of signaling
GO:0010647	0.400	positive regulation of cell communication
GO:0009967	0.393	positive regulation of signal transduction
GO:0030111	0.372	regulation of Wnt signaling pathway
GO:0051173	0.359	positive regulation of nitrogen compound metabolic process
GO:0019219	0.351	regulation of nucleobase-containing compound metabolic process
GO:2001141	0.339	regulation of RNA biosynthetic process
GO:0031325	0.338	positive regulation of cellular metabolic process
GO:0045595	0.334	regulation of cell differentiation
GO:0006355	0.333	regulation of DNA-templated transcription
GO:0040012	0.330	regulation of locomotion
GO:0051239	0.325	regulation of multicellular organismal process
GO:0001501	0.316	skeletal system development
GO:0065009	0.312	regulation of molecular function
GO:0060828	0.306	regulation of canonical Wnt signaling pathway
GO:0051216	0.302	cartilage development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005737	0.999	cytoplasm
GO:0071944	0.998	cell periphery
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0070013	0.994	intracellular organelle lumen
GO:0016020	0.990	membrane
GO:0005886	0.978	plasma membrane
GO:0005783	0.968	endoplasmic reticulum
GO:0031090	0.930	organelle membrane
GO:0005615	0.896	extracellular space
GO:0005788	0.877	endoplasmic reticulum lumen
GO:0031982	0.864	vesicle
GO:0098588	0.798	bounding membrane of organelle
GO:0031410	0.795	cytoplasmic vesicle
GO:0062023	0.721	collagen-containing extracellular matrix
GO:0012506	0.679	vesicle membrane
GO:0030659	0.609	cytoplasmic vesicle membrane
GO:0031981	0.466	nuclear lumen
GO:0005794	0.427	Golgi apparatus
GO:0032991	0.410	protein-containing complex
GO:1903561	0.388	extracellular vesicle
GO:0005654	0.339	nucleoplasm
GO:0009986	0.329	cell surface
GO:0030139	0.309	endocytic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]