StarFunc result for job id Q9H1K4

User Input

>input (315 residues)
MTHQDLSITAKLINGGVAGLVGVTCVFPIDLAKTRLQNQHGKAMYKGMIDCLMKTARAEG
FFGMYRGAAVNLTLVTPEKAIKLAANDFFRRLLMEDGMQRNLKMEMLAGCGAGMCQVVVT
CPMEMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLA
GLYRGLGATLLRDIPFSIIYFPLFANLNNLGFNELAGKASFAHSFVSGCVAGSIAAVAVT
PLDVLKTRIQTLKKGLGEDMYSGITDCARKLWIQEGPSAFMKGAGCRALVIAPLFGIAQG
VYFIGIGERILKCFD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H1K4	1.000	1.000	1.580E-40	315	1.000	1.000	Q9H1K4.pdb.gz	GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens OX=9606 GN=SLC25A18 PE=1 SV=1
2	AFDB:Q505J6	0.964	0.949	1.402E-34	320	0.873	0.859	Q505J6.pdb.gz	GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus OX=10116 GN=Slc25a18 PE=2 SV=2
3	AFDB:A0A0G2K5L2	0.929	0.907	1.411E-28	323	0.657	0.641	A0A0G2K5L2.pdb.gz	GHC1_RAT Mitochondrial glutamate carrier 1 OS=Rattus norvegicus OX=10116 GN=Slc25a22 PE=2 SV=1
4	AFDB:Q9VGF7	0.893	0.877	7.067E-24	321	0.527	0.517	Q9VGF7.pdb.gz	Q9VGF7_DROME Glutamate carrier 1, isoform A OS=Drosophila melanogaster OX=7227 GN=GC1 PE=1 SV=1
5	AFDB:Q5AL11	0.799	0.358	5.877E-19	731	0.387	0.167	Q5AL11.pdb.gz	Q5AL11_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGC1 PE=3 SV=1
6	AFDB:Q9QXX4	0.783	0.377	7.900E-19	676	0.394	0.183	Q9QXX4.pdb.gz	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
7	AFDB:O75746	0.779	0.375	2.089E-18	678	0.406	0.189	O75746.pdb.gz	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
8	AFDB:Q9VA73	0.794	0.371	3.187E-18	695	0.371	0.168	Q9VA73.pdb.gz	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
9	AFDB:Q12482	0.795	0.288	4.026E-17	902	0.362	0.126	Q12482.pdb.gz	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
10	AFDB:Q8INJ3	0.672	0.665	4.974E-17	319	0.483	0.476	Q8INJ3.pdb.gz	Q8INJ3_DROME AT03939p OS=Drosophila melanogaster OX=7227 GN=GC2 PE=2 SV=1
11	PDB:4c9qB	0.708	0.765	3.709E-11	290	0.216	0.234	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.740	0.790	1.929E-10	293	0.232	0.249	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.543	0.579	1.190E-7	292	0.229	0.247	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:2lckA	0.460	0.478	3.161E-3	297	0.225	0.239	2lckA.pdb.gz
15	PDB:4f4cA	0.153	0.058	4.635E-1	1250	0.114	0.029	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
16	PDB:5nbdA	0.142	0.096	5.044E-1	564	0.143	0.080	5nbdA.pdb.gz	Structural basis of inhibition of lipid-linked oligosaccharide flippase PglK by a conformational nanobody.
17	PDB:7s5xE	0.156	0.061	5.726E-1	1412	0.117	0.026	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
18	PDB:7p5cA	0.138	0.121	7.379E-1	392	0.111	0.089	7p5cA.pdb.gz
19	PDB:6xz6A	0.135	0.182	9.920E-1	213	0.089	0.131	6xz6A.pdb.gz
20	PDB:5k3iA	0.157	0.102	1.035	661	0.162	0.077	5k3iA.pdb.gz	Structural characterization of acyl-CoA oxidases reveals a direct link between pheromone biosynthesis and metabolic state in Caenorhabditis elegans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q505J6	0.0	574	320	0.873	0.859	GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus OX=10116 GN=Slc25a18 PE=2 SV=2
2	Q9DB41	0.0	577	320	0.879	0.866	GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus OX=10090 GN=Slc25a18 PE=1 SV=4
3	Q9H1K4	0.0	648	315	1.000	1.000	GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens OX=9606 GN=SLC25A18 PE=1 SV=1
4	Q9D6M3	8.17e-141	402	323	0.657	0.641	GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus OX=10090 GN=Slc25a22 PE=1 SV=1
5	A0A0G2K5L2	1.78e-140	401	323	0.657	0.641	GHC1_RAT Mitochondrial glutamate carrier 1 OS=Rattus norvegicus OX=10116 GN=Slc25a22 PE=2 SV=1
6	Q9H936	1.09e-139	399	323	0.660	0.644	GHC1_HUMAN Mitochondrial glutamate carrier 1 OS=Homo sapiens OX=9606 GN=SLC25A22 PE=1 SV=1
7	Q9VGF7	2.56e-102	304	321	0.533	0.523	Q9VGF7_DROME Glutamate carrier 1, isoform A OS=Drosophila melanogaster OX=7227 GN=GC1 PE=1 SV=1
8	Q8INJ3	1.08e-94	285	319	0.483	0.476	Q8INJ3_DROME AT03939p OS=Drosophila melanogaster OX=7227 GN=GC2 PE=2 SV=1
9	A8WHE0	5.53e-68	214	240	0.378	0.496	A8WHE0_DROME AT11783p OS=Drosophila melanogaster OX=7227 GN=GC2 PE=2 SV=1
10	Q9UJS0	1.77e-62	211	675	0.403	0.188	S2513_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2
11	Q8BH59	2.11e-61	208	677	0.403	0.188	S2512_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1
12	O75746	4.57e-61	207	678	0.403	0.187	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
13	F1LX07	9.85e-61	207	676	0.403	0.188	S2512_RAT Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Rattus norvegicus OX=10116 GN=Slc25a12 PE=3 SV=5
14	Q9QXX4	2.12e-60	206	676	0.390	0.182	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
15	Q9VA73	2.59e-59	203	695	0.387	0.176	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
16	Q5AL11	5.17e-54	189	731	0.384	0.166	Q5AL11_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGC1 PE=3 SV=1
17	Q12482	3.90e-52	186	902	0.359	0.125	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
18	P79110	1.02e-29	117	311	0.286	0.289	TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus OX=9913 GN=SLC25A1 PE=1 SV=1
19	Q7KSQ0	5.38e-29	115	317	0.254	0.252	Q7KSQ0_DROME LD46175p OS=Drosophila melanogaster OX=7227 GN=sea PE=1 SV=1
20	Q9VM51	7.93e-29	114	299	0.295	0.311	MME1_DROME Mitochondrial magnesium exporter 1 OS=Drosophila melanogaster OX=7227 GN=MME1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	1.9e-58	205.7	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329033

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377784	0.963	Guanylyl cyclase-activating protein 1
2	9606.ENSP00000245907	0.952	Complement C3
3	9606.ENSP00000421725	0.806	Vitamin D-binding protein
4	9606.ENSP00000261047	0.771	Guanylyl cyclase-activating protein 3
5	9606.ENSP00000385834	0.745	Serotransferrin
6	9606.ENSP00000156626	0.726	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
7	9606.ENSP00000360035	0.695	Protein phosphatase 1 regulatory subunit 3D
8	9606.ENSP00000322020	0.688	Mitochondrial glutamate carrier 1
9	9606.ENSP00000314879	0.668	Hydroperoxide isomerase ALOXE3
10	9606.ENSP00000230361	0.624	Guanylyl cyclase-activating protein 2
11	9606.ENSP00000404854	0.609	Protein NDRG1
12	9606.ENSP00000231751	0.603	Lactotransferrin
13	9606.ENSP00000355866	0.585	Dual specificity protein phosphatase 10
14	9606.ENSP00000322439	0.515	Elongation factor Tu, mitochondrial
15	9606.ENSP00000362924	0.509	Gelsolin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046943	0.999	carboxylic acid transmembrane transporter activity
GO:0015078	0.996	proton transmembrane transporter activity
GO:0015294	0.995	solute:monoatomic cation symporter activity
GO:0015171	0.993	amino acid transmembrane transporter activity
GO:0015295	0.990	solute:proton symporter activity
GO:0005488	0.966	binding
GO:1901702	0.957	salt transmembrane transporter activity
GO:0005515	0.853	protein binding
GO:0005416	0.461	amino acid:monoatomic cation symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0046942	0.995	carboxylic acid transport
GO:1905039	0.988	carboxylic acid transmembrane transport
GO:0006865	0.987	amino acid transport
GO:0015807	0.984	L-amino acid transport
GO:0042886	0.979	amide transport
GO:0015800	0.978	acidic amino acid transport
GO:0006835	0.967	dicarboxylic acid transport
GO:0003333	0.967	amino acid transmembrane transport
GO:1902475	0.962	L-alpha-amino acid transmembrane transport
GO:0015813	0.840	L-glutamate transmembrane transport
GO:0065007	0.428	biological regulation
GO:0050789	0.396	regulation of biological process
GO:0050794	0.359	regulation of cellular process
GO:0008152	0.305	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.998	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]