StarFunc result for job id Q9H1M3

User Input

>input (183 residues)
MKLLFPIFASLMLQYQVNTEFIGLRRCLMGLGRCRDHCNVDEKEIQKCKMKKCCVGPKVV
KLIKNYLQYGTPNVLNEDVQEMLKPAKNSSAVIQRKHILSVLPQIKSTSFFANTNFVIIP
NATPMNSATISTMTPGQITYTATSTKSNTKESRDSATASPPPAPPPPNILPTPSLELEEA
EEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H1M3	0.999	0.999	1.983E-28	183	1.000	1.000	Q9H1M3.pdb.gz	DB129_HUMAN Beta-defensin 129 OS=Homo sapiens OX=9606 GN=DEFB129 PE=1 SV=1
2	AFDB:Q582X8	0.118	0.041	8.851E-1	729	0.120	0.030	Q582X8.pdb.gz	Q582X8_TRYB2 TatD related DNase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.150 PE=4 SV=1
3	PDB:2lwlA	0.120	0.456	1.329	45	0.055	0.222	2lwlA.pdb.gz
4	PDB:1bnbA	0.144	0.571	1.518	38	0.055	0.263	1bnbA.pdb.gz
5	PDB:1e4rA	0.139	0.538	1.518	35	0.049	0.257	1e4rA.pdb.gz
6	AFDB:A0A384NQ31	0.137	0.060	1.965	512	0.137	0.049	A0A384NQ31.pdb.gz	A0A384NQ31_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
7	AFDB:Q99952	0.112	0.059	2.100	460	0.109	0.043	Q99952.pdb.gz	PTN18_HUMAN Tyrosine-protein phosphatase non-receptor type 18 OS=Homo sapiens OX=9606 GN=PTPN18 PE=1 SV=2
8	AFDB:O55145	0.155	0.097	3.344	393	0.137	0.064	O55145.pdb.gz	X3CL1_RAT Fractalkine OS=Rattus norvegicus OX=10116 GN=Cx3cl1 PE=2 SV=3
9	AFDB:Q6P6N5	0.120	0.061	3.573	408	0.148	0.066	Q6P6N5.pdb.gz	SPRE3_MOUSE Sprouty-related, EVH1 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Spred3 PE=1 SV=1
10	PDB:2gv1A	0.097	0.174	3.602	92	0.027	0.054	2gv1A.pdb.gz
11	PDB:3b4vD	0.098	0.086	3.850	213	0.033	0.028	3b4vD.pdb.gz
12	AFDB:Q940H8	0.123	0.053	4.081	532	0.169	0.058	Q940H8.pdb.gz	FRL4B_ARATH FRIGIDA-like protein 4b OS=Arabidopsis thaliana OX=3702 GN=FRL4B PE=1 SV=1
13	AFDB:Q57ZC9	0.116	0.092	4.362	245	0.066	0.049	Q57ZC9.pdb.gz	Q57ZC9_TRYB2 Mitochondrial RNA binding complex 1 subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.500 PE=4 SV=1
14	PDB:2azoB	0.118	0.098	4.397	227	0.027	0.022	2azoB.pdb.gz
15	AFDB:B7Z3U5	0.124	0.112	4.662	209	0.082	0.072	B7Z3U5.pdb.gz	B7Z3U5_HUMAN Decapping mRNA 2 OS=Homo sapiens OX=9606 GN=DCP2 PE=1 SV=1
16	AFDB:Q700C7	0.143	0.088	4.662	364	0.115	0.058	Q700C7.pdb.gz	SPCH_ARATH Transcription factor SPEECHLESS OS=Arabidopsis thaliana OX=3702 GN=SPCH PE=1 SV=1
17	PDB:5oqj5	0.115	0.235	4.699	66	0.044	0.121	5oqj5.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
18	PDB:4japC	0.115	0.070	5.022	353	0.044	0.023	4japC.pdb.gz	Crystal structure of Mycobacterium tuberculosis polyketide synthase 11 (PKS11) reveals intermediates in the synthesis of methyl-branched alkylpyrones.
19	PDB:6xywBo	0.126	0.197	5.736	99	0.060	0.111	6xywBo.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
20	PDB:1mgsA	0.091	0.184	6.130	73	0.044	0.110	1mgsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H1M3	5.20e-135	376	183	1.000	1.000	DB129_HUMAN Beta-defensin 129 OS=Homo sapiens OX=9606 GN=DEFB129 PE=1 SV=1
2	Q30KQ5	0.034	34.7	88	0.087	0.182	DB115_HUMAN Beta-defensin 115 OS=Homo sapiens OX=9606 GN=DEFB115 PE=1 SV=1
3	Q4WQI8	0.064	35.8	844	0.104	0.023	Q4WQI8_ASPFU Pheromone processing endoprotease KexB OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G12970 PE=3 SV=1
4	P59861	0.15	32.3	70	0.109	0.286	D131A_HUMAN Beta-defensin 131A OS=Homo sapiens OX=9606 GN=DEFB131A PE=1 SV=2
5	E7EQM5	0.30	33.9	558	0.126	0.041	E7EQM5_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
6	O94887	0.38	33.5	1054	0.109	0.019	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
7	Q8BVC1	0.49	32.7	179	0.104	0.106	DFB22_MOUSE Beta-defensin 22 OS=Mus musculus OX=10090 GN=Defb22 PE=1 SV=1
8	P13656	1.3	32.0	897	0.082	0.017	CHIA_ECOLI Probable bifunctional chitinase/lysozyme OS=Escherichia coli (strain K12) OX=83333 GN=chiA PE=1 SV=2
9	P97767	1.3	32.0	591	0.153	0.047	EYA1_MOUSE Eyes absent homolog 1 OS=Mus musculus OX=10090 GN=Eya1 PE=1 SV=3
10	Q20888	1.6	31.6	1561	0.131	0.015	Q20888_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=klp-4 PE=1 SV=3
11	Q8MQ20	1.6	31.6	1576	0.131	0.015	Q8MQ20_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=klp-4 PE=1 SV=2
12	Q6S004	2.7	31.2	1030	0.109	0.019	KIF6_DICDI Kinesin-related protein 6 OS=Dictyostelium discoideum OX=44689 GN=kif6 PE=2 SV=1
13	Q5J5C9	4.0	28.5	76	0.087	0.211	DB121_HUMAN Beta-defensin 121 OS=Homo sapiens OX=9606 GN=DEFB121 PE=1 SV=1
14	Q7DBI0	4.5	30.4	585	0.077	0.024	Q7DBI0_ECO57 Flagellin OS=Escherichia coli O157:H7 OX=83334 GN=fliC PE=3 SV=1
15	Q9VGE5	5.1	30.0	575	0.066	0.021	Q9VGE5_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=KLHL18 PE=2 SV=1
16	Q7Z6P3	6.2	30.0	1021	0.131	0.024	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
17	A6NCB9	6.3	29.6	586	0.142	0.044	A6NCB9_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=2
18	F8WB53	6.3	29.6	591	0.142	0.044	F8WB53_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
19	A0A2R8YGM9	6.6	29.6	585	0.142	0.044	A0A2R8YGM9_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
20	Q8IVH2	6.6	29.6	680	0.137	0.037	FOXP4_HUMAN Forkhead box protein P4 OS=Homo sapiens OX=9606 GN=FOXP4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10523 BEN	2.8e+02	13.2	BEN domain
2	PF13841 Defensin_beta_2	2.6	19.9	Beta defensin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246105

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371847	0.984	Beta-defensin 125
2	9606.ENSP00000417128	0.976	Beta-defensin 121
3	9606.ENSP00000335382	0.973	Beta-defensin 128
4	9606.ENSP00000381703	0.972	Beta-defensin 113
5	9606.ENSP00000371835	0.971	Beta-defensin 126
6	9606.ENSP00000371825	0.966	Beta-defensin 127
7	9606.ENSP00000360190	0.963	Beta-defensin 110
8	9606.ENSP00000326309	0.959	Beta-defensin 124
9	9606.ENSP00000371813	0.954	Beta-defensin 132
10	9606.ENSP00000365486	0.953	Beta-defensin 123
11	9606.ENSP00000253381	0.950	Beta-defensin 118
12	9606.ENSP00000383396	0.942	Beta-defensin 116
13	9606.ENSP00000319126	0.934	Beta-defensin 112
14	9606.ENSP00000365492	0.930	Defensin beta 119
15	9606.ENSP00000328359	0.929	Neutrophil defensin 3
16	9606.ENSP00000297439	0.928	Beta-defensin 1
17	9606.ENSP00000312702	0.917	Beta-defensin 114
18	9606.ENSP00000297435	0.914	Neutrophil defensin 4
19	9606.ENSP00000297436	0.914	Defensin-6
20	9606.ENSP00000329890	0.913	Defensin-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006950	0.996	response to stress
GO:0044419	0.995	biological process involved in interspecies interaction between organisms
GO:0009607	0.995	response to biotic stimulus
GO:0002376	0.992	immune system process
GO:0098542	0.985	defense response to other organism
GO:0006955	0.982	immune response
GO:0009617	0.952	response to bacterium
GO:0009987	0.911	cellular process
GO:0042742	0.839	defense response to bacterium
GO:0050829	0.763	defense response to Gram-negative bacterium
GO:0045087	0.720	innate immune response
GO:0065007	0.588	biological regulation
GO:0050789	0.574	regulation of biological process
GO:0061844	0.443	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0050794	0.366	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005622	0.859	intracellular anatomical structure
GO:0043229	0.852	intracellular organelle
GO:0005615	0.698	extracellular space
GO:0016020	0.591	membrane
GO:0043227	0.485	membrane-bounded organelle
GO:0043231	0.454	intracellular membrane-bounded organelle
GO:0070013	0.341	intracellular organelle lumen
GO:0012505	0.339	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]