StarFunc result for job id Q9H1R3

User Input

>input (596 residues)
MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASE
KGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGS
QDPGKPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVP
MTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEV
GQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVC
TCMEKATGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFME
YIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGH
LVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLS
PFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWL
NNLAEKAKRCNRRLKSQILLKKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H1R3	1.000	1.000	1.723E-88	596	1.000	1.000	Q9H1R3.pdb.gz	MYLK2_HUMAN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Homo sapiens OX=9606 GN=MYLK2 PE=1 SV=3
2	AFDB:P07313	0.683	0.670	3.827E-78	608	0.881	0.863	P07313.pdb.gz	MYLK2_RABIT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Oryctolagus cuniculus OX=9986 GN=MYLK2 PE=1 SV=3
3	AFDB:Q32MK0	0.561	0.409	8.985E-50	819	0.428	0.311	Q32MK0.pdb.gz	MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens OX=9606 GN=MYLK3 PE=1 SV=3
4	AFDB:Q3UIZ8	0.563	0.423	4.273E-48	795	0.401	0.301	Q3UIZ8.pdb.gz	MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus OX=10090 GN=Mylk3 PE=1 SV=1
5	AFDB:Q86YV6	0.485	0.741	8.513E-41	388	0.312	0.479	Q86YV6.pdb.gz	MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens OX=9606 GN=MYLK4 PE=1 SV=2
6	PDB:2x4fA	0.464	0.940	2.113E-34	289	0.294	0.606	2x4fA.pdb.gz	The Crystal Structure of the Human Myosin Light Chain Kinase Loc340156
7	AFDB:O01653	0.507	0.367	1.666E-32	832	0.258	0.185	O01653.pdb.gz	O01653_DROME Myosin light chain kinase isoform-II (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
8	AFDB:A1ZA70	0.499	0.409	3.318E-31	732	0.257	0.209	A1ZA70.pdb.gz	A1ZA70_DROME Stretchin-Mlck, isoform G OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=4 SV=2
9	AFDB:A1ZA69	0.497	0.324	4.125E-28	929	0.253	0.163	A1ZA69.pdb.gz	A1ZA69_DROME Stretchin-Mlck, isoform B OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=3 SV=1
10	PDB:2yaaA	0.460	0.895	1.024E-27	300	0.193	0.383	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
11	PDB:5u6yA	0.453	0.584	3.513E-23	459	0.158	0.205	5u6yA.pdb.gz
12	PDB:3soaA	0.448	0.605	3.642E-22	436	0.148	0.202	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
13	PDB:8bfsA	0.398	0.832	5.048E-22	274	0.158	0.343	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
14	PDB:4zhxA	0.398	0.570	1.162E-19	409	0.126	0.183	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
15	PDB:6b1uA	0.394	0.524	2.003E-19	442	0.128	0.172	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
16	PDB:7myjC	0.397	0.503	2.233E-19	465	0.126	0.161	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
17	PDB:4rgjA	0.409	0.522	3.094E-19	463	0.166	0.214	4rgjA.pdb.gz
18	PDB:6tcaA	0.392	0.650	3.094E-19	345	0.136	0.235	6tcaA.pdb.gz	MAP Kinase-Mediated Activation of RSK1 and MK2 Substrate Kinases.
19	AFDB:Q9C5H5	0.417	0.351	4.601E-19	716	0.190	0.158	Q9C5H5.pdb.gz	M3K5G_ARATH Mitogen-activated protein kinase kinase kinase 5 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK5 PE=1 SV=1
20	AFDB:F1QZR2	0.412	0.371	7.506E-19	664	0.188	0.169	F1QZR2.pdb.gz	F1QZR2_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=im:5916170 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07313	0.0	1032	608	0.883	0.865	MYLK2_RABIT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Oryctolagus cuniculus OX=9986 GN=MYLK2 PE=1 SV=3
2	P20689	0.0	899	610	0.789	0.770	MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus OX=10116 GN=Mylk2 PE=1 SV=2
3	Q8VCR8	0.0	902	613	0.822	0.799	MYLK2_MOUSE Myosin light chain kinase 2, skeletal/cardiac muscle OS=Mus musculus OX=10090 GN=Mylk2 PE=1 SV=2
4	Q9H1R3	0.0	1229	596	1.000	1.000	MYLK2_HUMAN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Homo sapiens OX=9606 GN=MYLK2 PE=1 SV=3
5	Q32MK0	7.08e-154	464	819	0.346	0.252	MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens OX=9606 GN=MYLK3 PE=1 SV=3
6	A8C984	3.75e-149	448	715	0.342	0.285	MYLK3_DANRE Myosin light chain kinase 3 OS=Danio rerio OX=7955 GN=mylk3 PE=2 SV=1
7	E9PT87	9.26e-148	447	786	0.337	0.256	MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus OX=10116 GN=Mylk3 PE=1 SV=1
8	Q3UIZ8	8.89e-145	440	795	0.332	0.249	MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus OX=10090 GN=Mylk3 PE=1 SV=1
9	Q86YV6	2.79e-131	391	388	0.304	0.466	MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens OX=9606 GN=MYLK4 PE=1 SV=2
10	G1U9Q7	1.17e-97	329	1903	0.262	0.082	G1U9Q7_MELGA Myosin light chain kinase, smooth muscle OS=Meleagris gallopavo OX=9103 GN=MYLK PE=3 SV=3
11	A1ZA70	1.23e-97	315	732	0.253	0.206	A1ZA70_DROME Stretchin-Mlck, isoform G OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=4 SV=2
12	Q9GTV1	6.06e-97	313	732	0.252	0.205	Q9GTV1_DROME Stretchin-MLCK OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
13	Q9GV79	1.77e-96	313	786	0.252	0.191	Q9GV79_DROME Stretchin-MLCK (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
14	A0A0B4JD64	4.92e-96	315	913	0.253	0.165	A0A0B4JD64_DROME Stretchin-Mlck, isoform M OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=3 SV=1
15	Q6PDN3	7.21e-96	324	1941	0.260	0.080	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
16	A1ZA69	9.33e-96	315	929	0.253	0.163	A1ZA69_DROME Stretchin-Mlck, isoform B OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=3 SV=1
17	Q15746	1.21e-95	323	1914	0.273	0.085	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
18	O01653	3.12e-95	311	832	0.253	0.181	O01653_DROME Myosin light chain kinase isoform-II (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
19	O01651	4.37e-95	313	929	0.252	0.161	O01651_DROME Myosin light chain kinase isoform-I OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
20	Q9GV80	3.11e-94	303	623	0.233	0.223	Q9GV80_DROME Stretchin-MLCK (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.071	23.8	ABC1 atypical kinase-like domain
2	PF01636 APH	1.7e+02	13.4	Phosphotransferase enzyme family
3	PF06293 Kdo	46	14.8	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF00069 Pkinase	1.2e-65	233.1	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	1.1e-35	134.7	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365162

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217652	0.957	Myosin regulatory light chain 12A
2	9606.ENSP00000279022	0.950	Myosin regulatory light polypeptide 9
3	9606.ENSP00000463559	0.879	Myosin regulatory light chain 12B
4	9606.ENSP00000379210	0.853	Myosin light chain 3
5	9606.ENSP00000228841	0.835	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
6	9606.ENSP00000306124	0.807	Protein kinase C epsilon type
7	9606.ENSP00000325239	0.790	Myosin light chain, phosphorylatable, fast skeletal muscle
8	9606.ENSP00000223364	0.768	Myosin regulatory light chain 2, atrial isoform
9	9606.ENSP00000383023	0.755	Myosin light chain 5
10	9606.ENSP00000450385	0.746	Myosin light chain 6B
11	9606.ENSP00000347055	0.737	Myosin light chain 4
12	9606.ENSP00000446955	0.736	Myosin light polypeptide 6
13	9606.ENSP00000223167	0.728	Myosin regulatory light chain 10
14	9606.ENSP00000380734	0.705	Protein FAM98B
15	9606.ENSP00000304643	0.681	Calmodulin-like protein 6
16	9606.ENSP00000469413	0.664	Serine/threonine-protein kinase PAK 4
17	9606.ENSP00000315299	0.660	Calmodulin-like protein 3
18	9606.ENSP00000272298	0.658	Calmodulin 2 (phosphorylase kinase, delta)
19	9606.ENSP00000369689	0.658	Calmodulin-like protein 5
20	9606.ENSP00000419081	0.658	Calmodulin-like protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004687	1.000	myosin light chain kinase activity
GO:0005516	0.996	calmodulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.978	regulation of cellular process
GO:0071704	0.967	organic substance metabolic process
GO:0044237	0.945	cellular metabolic process
GO:0044238	0.942	primary metabolic process
GO:0006807	0.937	nitrogen compound metabolic process
GO:0043170	0.915	macromolecule metabolic process
GO:0043412	0.886	macromolecule modification
GO:0006937	0.831	regulation of muscle contraction
GO:0006793	0.816	phosphorus metabolic process
GO:1901564	0.804	organonitrogen compound metabolic process
GO:0006796	0.760	phosphate-containing compound metabolic process
GO:0032501	0.694	multicellular organismal process
GO:0032502	0.569	developmental process
GO:0048856	0.551	anatomical structure development
GO:0016310	0.521	phosphorylation
GO:0032970	0.490	regulation of actin filament-based process
GO:0019538	0.483	protein metabolic process
GO:0032879	0.452	regulation of localization
GO:0051049	0.444	regulation of transport
GO:0003008	0.441	system process
GO:0006936	0.416	muscle contraction
GO:0006468	0.391	protein phosphorylation
GO:0060341	0.389	regulation of cellular localization
GO:1903115	0.373	regulation of actin filament-based movement
GO:0048518	0.363	positive regulation of biological process
GO:0061061	0.336	muscle structure development
GO:0050896	0.313	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.995	nucleus
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0043292	0.962	contractile fiber
GO:0005829	0.927	cytosol
GO:0030016	0.911	myofibril
GO:0030017	0.809	sarcomere
GO:0031982	0.390	vesicle
GO:0070013	0.368	intracellular organelle lumen
GO:0016020	0.327	membrane
GO:0012505	0.310	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22004	1.000	ATP + L-seryl-[myosin light chain] = ADP + H(+) + O-phospho-L-seryl-[myosin light chain]
EC:2.7.11.18	1.000	[myosin light-chain] kinase.

[back to server]