StarFunc result for job id Q9H204

User Input

>input (178 residues)
MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLV
SQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRN
ELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q920D3	0.666	0.666	3.760E-24	178	0.944	0.944	Q920D3.pdb.gz	MED28_MOUSE Mediator of RNA polymerase II transcription subunit 28 OS=Mus musculus OX=10090 GN=Med28 PE=1 SV=2
2	PDB:7lbmo	0.528	0.834	1.714E-12	108	0.601	0.991	7lbmo.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
3	AFDB:Q9VBQ9	0.586	0.555	5.269E-6	189	0.270	0.254	Q9VBQ9.pdb.gz	MED28_DROME Mediator of RNA polymerase II transcription subunit 28 OS=Drosophila melanogaster OX=7227 GN=MED28 PE=1 SV=1
4	AFDB:Q54DD4	0.333	0.332	1.743E-2	179	0.140	0.140	Q54DD4.pdb.gz	MED28_DICDI Putative mediator of RNA polymerase II transcription subunit 28 OS=Dictyostelium discoideum OX=44689 GN=med28 PE=3 SV=1
5	AFDB:Q9P7F7	0.230	0.186	1.367E-1	222	0.129	0.104	Q9P7F7.pdb.gz	SNF7_SCHPO Vacuolar-sorting protein snf7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf7 PE=3 SV=1
6	AFDB:Q7ZVC4	0.247	0.207	1.561E-1	220	0.135	0.109	Q7ZVC4.pdb.gz	CHM4B_DANRE Charged multivesicular body protein 4b OS=Danio rerio OX=7955 GN=chmp4b PE=2 SV=1
7	AFDB:O14340	0.200	0.039	1.783E-1	1310	0.129	0.018	O14340.pdb.gz	YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2F12.05c PE=1 SV=2
8	AFDB:O60104	0.285	0.150	2.036E-1	376	0.118	0.056	O60104.pdb.gz	MED7_SCHPO Mediator of RNA polymerase II transcription subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med7 PE=1 SV=1
9	AFDB:V6CLK4	0.296	0.073	2.036E-1	855	0.124	0.026	V6CLK4.pdb.gz	V6CLK4_CAEEL Calmodulin-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=kcnl-2 PE=4 SV=1
10	PDB:5n9jE	0.245	0.222	2.344E-1	201	0.090	0.080	5n9jE.pdb.gz
11	AFDB:Q8MQS4	0.220	0.056	3.464E-1	907	0.163	0.032	Q8MQS4.pdb.gz	Q8MQS4_DROME GH06923p OS=Drosophila melanogaster OX=7227 GN=Reps PE=1 SV=1
12	AFDB:F4K6Q7	0.320	0.091	3.702E-1	689	0.112	0.029	F4K6Q7.pdb.gz	F4K6Q7_ARATH Bromodomain and extraterminal domain protein 9 OS=Arabidopsis thaliana OX=3702 GN=BET9 PE=1 SV=1
13	PDB:3hajA	0.210	0.148	4.554E-1	286	0.124	0.077	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
14	PDB:6tz402	0.241	0.243	4.867E-1	176	0.129	0.131	6tz402.pdb.gz
15	PDB:7enag	0.339	0.359	5.558E-1	166	0.079	0.084	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:1ykhB	0.302	0.445	5.940E-1	114	0.112	0.175	1ykhB.pdb.gz
17	PDB:7emfD	0.267	0.297	6.784E-1	158	0.112	0.127	7emfD.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
18	PDB:5n9jZ	0.235	0.337	7.748E-1	119	0.062	0.092	5n9jZ.pdb.gz
19	PDB:7enav	0.246	0.305	7.748E-1	134	0.079	0.104	7enav.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
20	PDB:5svaU	0.311	0.349	8.849E-1	156	0.084	0.096	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H204	1.94e-129	362	178	1.000	1.000	MED28_HUMAN Mediator of RNA polymerase II transcription subunit 28 OS=Homo sapiens OX=9606 GN=MED28 PE=1 SV=1
2	Q920D3	2.65e-109	311	178	0.944	0.944	MED28_MOUSE Mediator of RNA polymerase II transcription subunit 28 OS=Mus musculus OX=10090 GN=Med28 PE=1 SV=2
3	Q9VBQ9	2.04e-26	101	189	0.258	0.243	MED28_DROME Mediator of RNA polymerase II transcription subunit 28 OS=Drosophila melanogaster OX=7227 GN=MED28 PE=1 SV=1
4	Q54DD4	1.79e-05	45.4	179	0.129	0.128	MED28_DICDI Putative mediator of RNA polymerase II transcription subunit 28 OS=Dictyostelium discoideum OX=44689 GN=med28 PE=3 SV=1
5	Q96AA8	0.36	33.5	810	0.124	0.027	JKIP2_HUMAN Janus kinase and microtubule-interacting protein 2 OS=Homo sapiens OX=9606 GN=JAKMIP2 PE=1 SV=1
6	Q5Y4N8	0.37	33.5	932	0.101	0.019	AGRE1_RAT Adhesion G protein-coupled receptor E2 OS=Rattus norvegicus OX=10116 GN=Adgre1 PE=2 SV=1
7	A0A8I6AK94	0.48	33.1	1261	0.169	0.024	A0A8I6AK94_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=3 SV=1
8	Q9LFA5	0.55	32.3	156	0.084	0.096	MED28_ARATH Mediator of RNA polymerase II transcription subunit 28 OS=Arabidopsis thaliana OX=3702 GN=MED28 PE=1 SV=1
9	A0A1D8PN92	0.65	32.7	1948	0.101	0.009	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
10	Q9WVQ0	1.9	31.6	1022	0.146	0.025	PMFBP_MOUSE Polyamine-modulated factor 1-binding protein 1 OS=Mus musculus OX=10090 GN=Pmfbp1 PE=2 SV=1
11	Q61147	2.0	31.2	1061	0.169	0.028	CERU_MOUSE Ceruloplasmin OS=Mus musculus OX=10090 GN=Cp PE=1 SV=2
12	E7EY31	2.2	31.2	1022	0.185	0.032	E7EY31_DANRE Coiled-coil domain-containing 57 OS=Danio rerio OX=7955 GN=ccdc57 PE=4 SV=1
13	Q9VXW9	2.2	31.2	984	0.140	0.025	Q9VXW9_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5877 PE=3 SV=1
14	Q582N0	2.3	31.2	608	0.140	0.041	Q582N0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.860 PE=4 SV=1
15	Q91Z80	2.7	30.8	1043	0.157	0.027	LIPA4_RAT Liprin-alpha-4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ppfia4 PE=1 SV=1
16	F4J0P2	2.9	30.8	1614	0.180	0.020	F4J0P2_ARATH Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=TWD40-1 PE=1 SV=1
17	P41004	4.3	30.4	1324	0.073	0.010	SMC4_SCHPO Structural maintenance of chromosomes protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut3 PE=1 SV=2
18	Q76P24	4.3	30.4	3095	0.118	0.007	HD_DICDI HD protein homolog OS=Dictyostelium discoideum OX=44689 GN=htt PE=3 SV=1
19	B2RDH6	4.7	30.0	596	0.101	0.030	B2RDH6_HUMAN cDNA, FLJ96613, highly similar to Homo sapiens vacuolar protein sorting 33A (yeast) (VPS33A), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
20	Q28298	5.1	30.0	1534	0.129	0.015	RRBP1_CANLF Ribosome-binding protein 1 OS=Canis lupus familiaris OX=9615 GN=RRBP1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20140 DUF6530	1.9e+02	13.3	Family of unknown function (DUF6530)
2	PF07743 HSCB_C	5.6e+02	12.4	HSCB C-terminal oligomerisation domain
3	PF13601 HTH_34	39	15.8	Winged helix DNA-binding domain
4	PF11594 Med28	5e-40	147.4	Mediator complex subunit 28

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000237380

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000255764	0.996	Mediator of RNA polymerase II transcription subunit 10
2	9606.ENSP00000286317	0.996	Mediator of RNA polymerase II transcription subunit 7
3	9606.ENSP00000481920	0.996	Mediator of RNA polymerase II transcription subunit 6
4	9606.ENSP00000251871	0.992	Mediator of RNA polymerase II transcription subunit 17
5	9606.ENSP00000337340	0.992	Mediator of RNA polymerase II transcription subunit 19
6	9606.ENSP00000428982	0.991	Cyclin-C
7	9606.ENSP00000297347	0.989	Mediator of RNA polymerase II transcription subunit 30
8	9606.ENSP00000370938	0.989	Cyclin-dependent kinase 8
9	9606.ENSP00000282892	0.986	Mediator of RNA polymerase II transcription subunit 21
10	9606.ENSP00000357907	0.986	Cyclin dependent kinase 19
11	9606.ENSP00000380888	0.986	Mediator of RNA polymerase II transcription subunit 13
12	9606.ENSP00000314343	0.981	Mediator of RNA polymerase II transcription subunit 29
13	9606.ENSP00000362948	0.981	Mediator of RNA polymerase II transcription subunit 18
14	9606.ENSP00000300651	0.980	Mediator of RNA polymerase II transcription subunit 1
15	9606.ENSP00000265350	0.977	Mediator of RNA polymerase II transcription subunit 20
16	9606.ENSP00000258648	0.976	Mediator of RNA polymerase II transcription subunit 4
17	9606.ENSP00000290663	0.976	Mediator of RNA polymerase II transcription subunit 8
18	9606.ENSP00000268711	0.974	Mediator of RNA polymerase II transcription subunit 9
19	9606.ENSP00000292035	0.974	Mediator of RNA polymerase II transcription subunit 27
20	9606.ENSP00000482438	0.973	Mediator of RNA polymerase II transcription subunit 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0098727	0.994	maintenance of cell number
GO:0045595	0.988	regulation of cell differentiation
GO:0019827	0.983	stem cell population maintenance
GO:0051147	0.983	regulation of muscle cell differentiation
GO:0051093	0.977	negative regulation of developmental process
GO:0048523	0.973	negative regulation of cellular process
GO:0045596	0.962	negative regulation of cell differentiation
GO:0035019	0.955	somatic stem cell population maintenance
GO:0051148	0.923	negative regulation of muscle cell differentiation
GO:0009987	0.736	cellular process
GO:0019222	0.671	regulation of metabolic process
GO:0080090	0.593	regulation of primary metabolic process
GO:0031323	0.592	regulation of cellular metabolic process
GO:0060255	0.590	regulation of macromolecule metabolic process
GO:0051171	0.587	regulation of nitrogen compound metabolic process
GO:0010468	0.533	regulation of gene expression
GO:0008152	0.495	metabolic process
GO:0044238	0.475	primary metabolic process
GO:0051150	0.452	regulation of smooth muscle cell differentiation
GO:0071704	0.439	organic substance metabolic process
GO:0019219	0.421	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.416	regulation of biosynthetic process
GO:2001141	0.407	regulation of RNA biosynthetic process
GO:0006355	0.401	regulation of DNA-templated transcription
GO:0006807	0.356	nitrogen compound metabolic process
GO:0048518	0.342	positive regulation of biological process
GO:0043170	0.342	macromolecule metabolic process
GO:0044237	0.313	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0005654	0.997	nucleoplasm
GO:0043232	0.982	intracellular non-membrane-bounded organelle
GO:0005667	0.954	transcription regulator complex
GO:0005737	0.946	cytoplasm
GO:0090575	0.942	RNA polymerase II transcription regulator complex
GO:0071944	0.925	cell periphery
GO:0070847	0.922	core mediator complex
GO:0016020	0.718	membrane
GO:0005856	0.504	cytoskeleton
GO:0005886	0.375	plasma membrane
GO:0005829	0.350	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]