StarFunc result for job id Q9H211

User Input

>input (546 residues)
MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRD
QARPPARRRLRLSVDEVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTI
SELASCLQRARELGARVRALKASAQDAGESCTPEAEGRPEEPCGEKAPAYQRFHALAQPG
LPGLVLPYKYQVLAEMFRSMDTIVGMLHNRSETPTFAKVQRGVQDMMRRRFEECNVGQIK
TVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEADGAAPQLTASRLLQRRQIFSQ
KLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALPQPPATEKLTTA
QEVLARARNLISPRMEKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQ
DLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVFVSERKPALSMEVACA
RMVGSCCTIMSPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDKAADLAHITARLAHQT
RAEEGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H211	1.000	1.000	1.039E-79	546	1.000	1.000	Q9H211.pdb.gz	CDT1_HUMAN DNA replication factor Cdt1 OS=Homo sapiens OX=9606 GN=CDT1 PE=1 SV=3
2	AFDB:E7F2R5	0.643	0.521	3.093E-48	678	0.489	0.394	E7F2R5.pdb.gz	E7F2R5_DANRE Chromatin licensing and DNA replication factor 1 OS=Danio rerio OX=7955 GN=cdt1 PE=1 SV=1
3	AFDB:F8W3F6	0.378	0.449	7.239E-28	458	0.333	0.397	F8W3F6.pdb.gz
4	AFDB:Q86S68	0.279	0.226	1.805E-23	684	0.240	0.192	Q86S68.pdb.gz	Q86S68_CAEEL CDT1 Geminin-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cdt-1 PE=1 SV=2
5	PDB:2wvrC	0.308	0.952	1.160E-22	172	0.313	0.994	2wvrC.pdb.gz
6	AFDB:Q9SJW9	0.201	0.193	2.366E-13	571	0.187	0.179	Q9SJW9.pdb.gz	CDT1A_ARATH CDT1-like protein a, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CDT1A PE=1 SV=1
7	AFDB:Q9M1S9	0.194	0.217	5.093E-11	486	0.152	0.171	Q9M1S9.pdb.gz	CDT1B_ARATH CDT1-like protein b OS=Arabidopsis thaliana OX=3702 GN=CDT1B PE=1 SV=1
8	PDB:5v8f8	0.171	0.179	1.562E-6	519	0.077	0.081	5v8f8.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
9	PDB:5xf8C	0.181	0.210	1.357E-3	469	0.064	0.075	5xf8C.pdb.gz
10	AFDB:A5D8S6	0.113	0.101	2.577E-2	637	0.115	0.099	A5D8S6.pdb.gz	A5D8S6_DANRE Tnfrsf21 protein OS=Danio rerio OX=7955 GN=wu:fc29a09 PE=2 SV=1
11	AFDB:A0A024RBB9	0.125	0.085	1.492E-1	911	0.110	0.066	A0A024RBB9.pdb.gz
12	AFDB:P36126	0.066	0.032	1.835E-1	1683	0.095	0.031	P36126.pdb.gz	SPO14_YEAST Phospholipase D1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPO14 PE=1 SV=3
13	AFDB:Q9VKK1	0.070	0.037	2.142E-1	1354	0.139	0.056	Q9VKK1.pdb.gz	EDC4_DROME Enhancer of mRNA-decapping protein 4 homolog OS=Drosophila melanogaster OX=7227 GN=Ge-1 PE=1 SV=2
14	PDB:2qbyB	0.107	0.148	2.256E-1	368	0.046	0.068	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
15	PDB:6qpqD	0.119	0.605	3.239E-1	82	0.016	0.110	6qpqD.pdb.gz
16	PDB:1r1uC	0.095	0.347	3.782E-1	98	0.035	0.194	1r1uC.pdb.gz
17	PDB:6wg3C	0.081	0.167	3.782E-1	248	0.060	0.133	6wg3C.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
18	PDB:6v9iC	0.108	0.085	4.194E-1	730	0.027	0.021	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
19	PDB:7qenC	0.111	0.182	4.416E-1	291	0.066	0.124	7qenC.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
20	PDB:4ev0D	0.121	0.282	4.650E-1	214	0.038	0.098	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R4E9	0.0	705	557	0.734	0.720	CDT1_MOUSE DNA replication factor Cdt1 OS=Mus musculus OX=10090 GN=Cdt1 PE=1 SV=1
2	Q9H211	0.0	1090	546	1.000	1.000	CDT1_HUMAN DNA replication factor Cdt1 OS=Homo sapiens OX=9606 GN=CDT1 PE=1 SV=3
3	Q9I9A7	1.48e-178	518	617	0.485	0.429	CDT1_XENLA DNA replication factor Cdt1 OS=Xenopus laevis OX=8355 GN=cdt1 PE=1 SV=2
4	E7F2R5	1.96e-165	487	678	0.476	0.383	E7F2R5_DANRE Chromatin licensing and DNA replication factor 1 OS=Danio rerio OX=7955 GN=cdt1 PE=1 SV=1
5	Q7JVY2	1.27e-69	239	743	0.278	0.205	Q7JVY2_DROME Double parked, isoform A OS=Drosophila melanogaster OX=7227 GN=dup PE=1 SV=1
6	Q86S68	3.48e-14	77.8	684	0.174	0.139	Q86S68_CAEEL CDT1 Geminin-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cdt-1 PE=1 SV=2
7	Q9M1S9	2.65e-05	49.3	486	0.055	0.062	CDT1B_ARATH CDT1-like protein b OS=Arabidopsis thaliana OX=3702 GN=CDT1B PE=1 SV=1
8	Q9SJW9	4.01e-05	48.9	571	0.055	0.053	CDT1A_ARATH CDT1-like protein a, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CDT1A PE=1 SV=1
9	B9VMQ5	2.0	33.9	807	0.044	0.030	B9VMQ5_APIME Neuroligin 3 precursor OS=Apis mellifera OX=7460 GN=NLG-3 PE=4 SV=1
10	P40382	4.2	32.3	444	0.037	0.045	CDT1_SCHPO Cell division cycle protein cdt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdt1 PE=1 SV=2
11	Q9Z1Z0	5.3	32.3	959	0.026	0.015	USO1_MOUSE General vesicular transport factor p115 OS=Mus musculus OX=10090 GN=Uso1 PE=1 SV=2
12	Q7ZYW6	8.5	31.6	910	0.046	0.027	Q7ZYW6_DANRE Origin recognition complex subunit 1 OS=Danio rerio OX=7955 GN=orc1l PE=1 SV=1
13	Q8VBX6	8.8	32.0	2055	0.062	0.017	MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2
14	F1QLF9	9.6	31.6	912	0.040	0.024	F1QLF9_DANRE Origin recognition complex subunit 1 OS=Danio rerio OX=7955 GN=orc1l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08839 CDT1	3.6e-56	201.6	DNA replication factor CDT1 like
2	PF16679 CDT1_C	1.5e-29	113.6	DNA replication factor Cdt1 C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301019

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000209728	0.999	Cell division control protein 6 homolog
2	9606.ENSP00000216122	0.999	DNA replication licensing factor MCM5
3	9606.ENSP00000219097	0.999	Origin recognition complex subunit 6
4	9606.ENSP00000230056	0.999	Geminin
5	9606.ENSP00000262105	0.999	DNA replication licensing factor MCM4
6	9606.ENSP00000264156	0.999	DNA replication licensing factor MCM6
7	9606.ENSP00000265056	0.999	DNA replication licensing factor MCM2
8	9606.ENSP00000274026	0.999	Cyclin-A2
9	9606.ENSP00000307288	0.999	DNA replication licensing factor MCM7
10	9606.ENSP00000355958	0.999	Denticleless protein homolog
11	9606.ENSP00000360623	0.999	Origin recognition complex subunit 1
12	9606.ENSP00000480987	0.999	DNA replication licensing factor MCM3
13	9606.ENSP00000274255	0.998	S-phase kinase-associated protein 2
14	9606.ENSP00000266970	0.997	Cyclin-dependent kinase 2
15	9606.ENSP00000368458	0.995	Proliferating cell nuclear antigen
16	9606.ENSP00000418268	0.994	Protein MCM10 homolog
17	9606.ENSP00000259021	0.993	Histone acetyltransferase KAT7
18	9606.ENSP00000234296	0.992	Origin recognition complex subunit 2
19	9606.ENSP00000405726	0.992	Cell division control protein 45 homolog
20	9606.ENSP00000378699	0.991	Cyclin-dependent kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:1901363	0.639	heterocyclic compound binding
GO:0097159	0.639	organic cyclic compound binding
GO:0003676	0.618	nucleic acid binding
GO:0003677	0.524	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0051052	0.981	regulation of DNA metabolic process
GO:0071840	0.978	cellular component organization or biogenesis
GO:0000075	0.978	cell cycle checkpoint signaling
GO:0051276	0.968	chromosome organization
GO:0031570	0.966	DNA integrity checkpoint signaling
GO:0000076	0.964	DNA replication checkpoint signaling
GO:0006807	0.961	nitrogen compound metabolic process
GO:0051173	0.939	positive regulation of nitrogen compound metabolic process
GO:0043170	0.938	macromolecule metabolic process
GO:0031325	0.938	positive regulation of cellular metabolic process
GO:0010604	0.932	positive regulation of macromolecule metabolic process
GO:0044260	0.930	cellular macromolecule metabolic process
GO:0051128	0.928	regulation of cellular component organization
GO:0007346	0.919	regulation of mitotic cell cycle
GO:1903047	0.918	mitotic cell cycle process
GO:0006259	0.915	DNA metabolic process
GO:0006260	0.895	DNA replication
GO:0045787	0.893	positive regulation of cell cycle
GO:0033043	0.874	regulation of organelle organization
GO:0090068	0.871	positive regulation of cell cycle process
GO:1901990	0.861	regulation of mitotic cell cycle phase transition
GO:0006275	0.857	regulation of DNA replication
GO:0033044	0.841	regulation of chromosome organization
GO:0090329	0.839	regulation of DNA-templated DNA replication
GO:0051983	0.825	regulation of chromosome segregation
GO:0033045	0.815	regulation of sister chromatid segregation
GO:0045935	0.810	positive regulation of nucleobase-containing compound metabolic process
GO:0007059	0.808	chromosome segregation
GO:0010605	0.805	negative regulation of macromolecule metabolic process
GO:1905818	0.800	regulation of chromosome separation
GO:1902099	0.800	regulation of metaphase/anaphase transition of cell cycle
GO:0030174	0.798	regulation of DNA-templated DNA replication initiation
GO:0051054	0.784	positive regulation of DNA metabolic process
GO:0051053	0.755	negative regulation of DNA metabolic process
GO:0006261	0.754	DNA-templated DNA replication
GO:0010965	0.716	regulation of mitotic sister chromatid separation
GO:0030071	0.716	regulation of mitotic metaphase/anaphase transition
GO:0051179	0.677	localization
GO:0008156	0.645	negative regulation of DNA replication
GO:0098813	0.634	nuclear chromosome segregation
GO:0045740	0.621	positive regulation of DNA replication
GO:0065009	0.618	regulation of molecular function
GO:2000104	0.590	negative regulation of DNA-templated DNA replication
GO:0051641	0.559	cellular localization
GO:0140014	0.553	mitotic nuclear division
GO:0050000	0.552	chromosome localization
GO:0051303	0.544	establishment of chromosome localization
GO:0051130	0.508	positive regulation of cellular component organization
GO:0010638	0.483	positive regulation of organelle organization
GO:0051310	0.483	metaphase plate congression
GO:0048583	0.461	regulation of response to stimulus
GO:0000819	0.414	sister chromatid segregation
GO:0006950	0.396	response to stress
GO:0000070	0.391	mitotic sister chromatid segregation
GO:0033554	0.383	cellular response to stress
GO:0044085	0.375	cellular component biogenesis
GO:0022607	0.341	cellular component assembly
GO:0009966	0.321	regulation of signal transduction
GO:1902531	0.309	regulation of intracellular signal transduction
GO:2001252	0.304	positive regulation of chromosome organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0005694	0.994	chromosome
GO:0098687	0.981	chromosomal region
GO:0032991	0.885	protein-containing complex
GO:0099080	0.845	supramolecular complex
GO:0000793	0.777	condensed chromosome
GO:0016604	0.776	nuclear body
GO:0000775	0.757	chromosome, centromeric region
GO:0000776	0.737	kinetochore
GO:0005737	0.714	cytoplasm
GO:0005829	0.537	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]