StarFunc result for job id Q9H251

User Input

>input (1400 residues)
MGRHVATSCHVAWLLVLISGCWGQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLAQDM
DNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNI
QVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSQFFAI
DSARGIVTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLP
YSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLNGLLD
RENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITEL
AQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLD
YETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVL
TVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTIIARDGGG
EETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSI
VSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIE
VFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQFR
INARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKD
APYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAML
DRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVL
EGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAE
YQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCT
DNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVGK
RHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQLKATDADEGEFGRVWYR
ILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLGPMRSSVRVIVYVED
INDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDE
STGLIITVNYLDYETKTSYMMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNASYEA
AILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDRE
KGDFYTLTVVADDGGPKVDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VFH5	0.241	0.179	1.357E-99	1981	0.299	0.212	Q9VFH5.pdb.gz	Q9VFH5_DROME Cadherin 88C OS=Drosophila melanogaster OX=7227 GN=Cad88C PE=4 SV=3
2	AFDB:Q9VVG0	0.204	0.163	4.668E-97	1820	0.311	0.239	Q9VVG0.pdb.gz	Q9VVG0_DROME Cadherin 74A, isoform A OS=Drosophila melanogaster OX=7227 GN=Cad74A PE=2 SV=1
3	AFDB:A0A0R4IZF0	0.165	0.130	3.106E-84	1907	0.263	0.193	A0A0R4IZF0.pdb.gz
4	AFDB:Q99PJ1	0.144	0.106	2.013E-82	1943	0.249	0.180	Q99PJ1.pdb.gz	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
5	AFDB:Q5ICW6	0.158	0.128	1.951E-81	1796	0.254	0.198	Q5ICW6.pdb.gz	Q5ICW6_DANRE Protocadherin 15a OS=Danio rerio OX=7955 GN=PCDH15 PE=2 SV=1
6	AFDB:Q9VAF5	0.207	0.173	7.474E-78	1706	0.246	0.202	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
7	AFDB:Q96QU1	0.144	0.113	1.002E-76	1955	0.241	0.173	Q96QU1.pdb.gz	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
8	AFDB:Q0ZM14	0.159	0.123	1.206E-76	1899	0.254	0.187	Q0ZM14.pdb.gz	PCD15_CHICK Protocadherin-15 OS=Gallus gallus OX=9031 GN=Pcdh15 PE=1 SV=1
9	AFDB:Q9BYE9	0.231	0.244	1.279E-69	1310	0.219	0.234	Q9BYE9.pdb.gz	CDHR2_HUMAN Cadherin-related family member 2 OS=Homo sapiens OX=9606 GN=CDHR2 PE=1 SV=2
10	AFDB:G5EDK5	0.176	0.103	1.540E-69	2596	0.195	0.105	G5EDK5.pdb.gz	CELR_CAEEL Cadherin EGF LAG seven-pass G-type receptor fmi-1 OS=Caenorhabditis elegans OX=6239 GN=fmi-1 PE=1 SV=1
11	PDB:7sqcO0	0.116	0.130	2.891E-19	1140	0.075	0.092	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:4aq1A	0.090	0.151	2.435E-15	721	0.074	0.143	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:5a42A	0.074	0.068	2.396E-13	1597	0.099	0.087	5a42A.pdb.gz
14	PDB:1e07A	0.115	0.187	5.780E-13	642	0.057	0.125	1e07A.pdb.gz
15	PDB:6velC	0.123	0.705	1.461E-12	209	0.038	0.254	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
16	PDB:5oj2B	0.087	0.141	9.769E-12	692	0.063	0.127	5oj2B.pdb.gz
17	PDB:7q1yA	0.078	0.079	9.039E-11	1374	0.071	0.073	7q1yA.pdb.gz
18	PDB:7q5zA	0.062	0.064	1.730E-10	1344	0.075	0.078	7q5zA.pdb.gz
19	PDB:7nycA	0.067	0.063	4.173E-10	1542	0.062	0.056	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:6h03A	0.073	0.080	1.676E-9	1223	0.075	0.086	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R7G8	0.0	632	436	0.220	0.706	F1R7G8_DANRE Cadherin-related 23 (Fragment) OS=Danio rerio OX=7955 GN=cdh23 PE=1 SV=1
2	P58365	0.0	2706	3317	0.949	0.400	CAD23_RAT Cadherin-23 OS=Rattus norvegicus OX=10116 GN=Cdh23 PE=2 SV=1
3	Q6QQE1	0.0	1985	3366	0.696	0.289	Q6QQE1_DANRE Cadherin 23 OS=Danio rerio OX=7955 GN=cdh23 PE=1 SV=1
4	Q99PF4	0.0	2709	3354	0.947	0.395	CAD23_MOUSE Cadherin-23 OS=Mus musculus OX=10090 GN=Cdh23 PE=1 SV=2
5	Q9H251	0.0	2842	3354	1.000	0.417	CAD23_HUMAN Cadherin-23 OS=Homo sapiens OX=9606 GN=CDH23 PE=1 SV=2
6	Q2PZL6	3.06e-145	494	4981	0.311	0.087	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
7	Q6V0I7	6.14e-143	487	4981	0.311	0.087	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
8	Q9VVG0	2.92e-133	454	1820	0.319	0.245	Q9VVG0_DROME Cadherin 74A, isoform A OS=Drosophila melanogaster OX=7227 GN=Cad74A PE=2 SV=1
9	Q8IGX4	3.21e-132	451	1820	0.318	0.245	Q8IGX4_DROME RE10062p OS=Drosophila melanogaster OX=7227 GN=Cad74A PE=2 SV=1
10	X2J8E9	4.03e-131	452	3556	0.306	0.121	X2J8E9_DROME Dachsous, isoform B OS=Drosophila melanogaster OX=7227 GN=ds PE=4 SV=1
11	Q24292	5.89e-131	451	3503	0.306	0.122	DS_DROME Protein dachsous OS=Drosophila melanogaster OX=7227 GN=ds PE=1 SV=3
12	A2BGT8	1.37e-130	450	4611	0.293	0.089	A2BGT8_DANRE FAT atypical cadherin 1a OS=Danio rerio OX=7955 GN=fat PE=1 SV=1
13	P33450	1.62e-127	441	5147	0.309	0.084	FAT_DROME Cadherin-related tumor suppressor OS=Drosophila melanogaster OX=7227 GN=ft PE=1 SV=3
14	Q14517	1.84e-127	441	4588	0.304	0.093	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
15	Q9VFH5	1.61e-126	436	1981	0.300	0.212	Q9VFH5_DROME Cadherin 88C OS=Drosophila melanogaster OX=7227 GN=Cad88C PE=4 SV=3
16	Q9WU10	8.72e-126	436	4589	0.301	0.092	Q9WU10_RAT Protocadherin OS=Rattus norvegicus OX=10116 GN=Fat1 PE=2 SV=1
17	F2Z4A3	1.15e-125	436	4590	0.309	0.094	F2Z4A3_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
18	F1QA09	1.29e-125	435	4546	0.299	0.092	F1QA09_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=2
19	X1WCY4	1.29e-125	435	4578	0.299	0.092	X1WCY4_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
20	A0A087WRT4	1.61e-125	435	4602	0.309	0.094	A0A087WRT4_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	9e-215	707.3	Cadherin domain
2	PF08266 Cadherin_2	1.6e-11	55.2	Cadherin-like
3	PF16184 Cadherin_3	5.9e-13	60.1	Cadherin-like
4	PF17803 Cadherin_4	0.015	27.3	Bacterial cadherin-like domain
5	PF08758 Cadherin_pro	0.0039	28.7	Cadherin prodomain like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005565645.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005565887.1	0.996	Uncharacterized protein
2	9541.XP_005578542.1	0.994	USH1 protein network component harmonin
3	9541.XP_005579213.1	0.935	Uncharacterized protein
4	9541.XP_005581021.1	0.897	Autosomal recessive deafness type 31 protein
5	9541.XP_005540904.1	0.870	Uncharacterized protein
6	9541.XP_005584944.1	0.864	Usher syndrome type-1G protein
7	9541.XP_005546153.1	0.819	Uncharacterized protein
8	9541.XP_005557418.1	0.819	Monogenic audiogenic seizure susceptibility protein 1-like protein
9	9541.XP_005583115.1	0.772	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
10	9541.XP_005560249.1	0.748	Kinase-interacting protein 2
11	9541.XP_005582489.1	0.716	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
12	9541.XP_005596092.1	0.713	LOW QUALITY PROTEIN: four jointed box 1 (Drosophila)
13	9541.XP_005552579.1	0.705	Uncharacterized protein
14	9541.XP_005572247.1	0.703	Uncharacterized protein
15	9541.XP_005585499.1	0.680	One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
16	9541.XP_005554880.1	0.677	Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules (By similarity)
17	9541.XP_005576403.1	0.676	Uncharacterized protein
18	9541.XP_005550555.1	0.673	Sodium-independent transporter of chloride and iodide.
19	9541.XP_005556543.1	0.669	Uncharacterized protein
20	9541.XP_005579401.1	0.669	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050877	0.972	nervous system process
GO:0007605	0.961	sensory perception of sound
GO:0009987	0.856	cellular process
GO:0048856	0.625	anatomical structure development
GO:0007275	0.596	multicellular organism development
GO:0048731	0.376	system development
GO:0051179	0.315	localization
GO:0050953	0.311	sensory perception of light stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.996	membrane
GO:0043226	0.979	organelle
GO:0005622	0.978	intracellular anatomical structure
GO:0043227	0.968	membrane-bounded organelle
GO:0005886	0.955	plasma membrane
GO:0043229	0.947	intracellular organelle
GO:0042995	0.736	cell projection
GO:0120025	0.731	plasma membrane bounded cell projection
GO:0043232	0.493	intracellular non-membrane-bounded organelle
GO:0030054	0.377	cell junction
GO:0005929	0.373	cilium
GO:0043005	0.361	neuron projection
GO:0098590	0.361	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]