StarFunc result for job id Q9H252

User Input

>input (994 residues)
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKCSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQ
IPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGACSYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFSGAGK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
VSLHAQPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFAESFWSKLEVTFNLRDAAGG
LHSSPRQAPGSQDHQGFFLSDNQSGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHP
DAAPPLSISDASGLWPELLQEMPPRHSPQSPQEDPDCWPLKLGSRLEQLQAQMNRLESRV
SSDLSRILQLLQKPMPQGHASYILEAPASNDLALVPIASETTSPGPRLPQGFLPPAQTPS
YGDLDDCSPKHRNSSPRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICG
PCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54853	0.712	0.743	0.000	950	0.862	0.902	O54853.pdb.gz	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
2	AFDB:Q9H252	1.000	1.000	0.000	994	1.000	1.000	Q9H252.pdb.gz	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
3	AFDB:B3DJX4	0.662	0.558	6.034E-99	1186	0.651	0.546	B3DJX4.pdb.gz
4	AFDB:Q9NS40	0.636	0.532	9.948E-96	1196	0.603	0.501	Q9NS40.pdb.gz	KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens OX=9606 GN=KCNH7 PE=1 SV=2
5	AFDB:O08962	0.638	0.549	6.129E-94	1163	0.635	0.543	O08962.pdb.gz	KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus OX=10116 GN=Kcnh2 PE=1 SV=1
6	AFDB:O44164	0.618	0.642	1.529E-67	956	0.321	0.334	O44164.pdb.gz	O44164_CAEEL Potassium voltage-gated channel protein eag OS=Caenorhabditis elegans OX=6239 GN=egl-2 PE=4 SV=2
7	AFDB:Q8NCM2	0.614	0.617	1.960E-66	988	0.330	0.332	Q8NCM2.pdb.gz	KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3
8	AFDB:B3DHL9	0.607	0.628	2.059E-66	959	0.325	0.337	B3DHL9.pdb.gz
9	AFDB:Q63472	0.602	0.621	2.059E-66	962	0.324	0.335	Q63472.pdb.gz	KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1
10	AFDB:O95259	0.601	0.604	1.146E-65	989	0.326	0.328	O95259.pdb.gz	KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
11	PDB:7rhsA	0.397	0.821	1.680E-25	456	0.121	0.263	7rhsA.pdb.gz
12	PDB:7wswA	0.371	0.721	3.188E-24	472	0.107	0.225	7wswA.pdb.gz
13	PDB:7n15A	0.379	0.682	5.207E-24	520	0.114	0.217	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
14	PDB:7rhsD	0.381	0.801	1.263E-22	441	0.090	0.202	7rhsD.pdb.gz
15	PDB:7o4hB	0.379	0.747	5.503E-22	468	0.117	0.248	7o4hB.pdb.gz
16	PDB:7calA	0.381	0.796	7.757E-22	444	0.098	0.218	7calA.pdb.gz
17	PDB:7xufA	0.359	0.687	1.048E-19	476	0.102	0.212	7xufA.pdb.gz
18	PDB:7o4hD	0.263	0.627	1.509E-12	383	0.058	0.151	7o4hD.pdb.gz
19	PDB:6eo1A	0.125	0.267	1.199E-7	355	0.066	0.186	6eo1A.pdb.gz
20	PDB:4byyA	0.110	0.451	1.323E-7	226	0.029	0.128	4byyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A8WHX9	551	914	0.326	0.354	A8WHX9_DANRE Potassium voltage-gated channel, subfamily H (eag-related), member 3 (Fragment) OS=Danio rerio OX=7955 GN=kcnh3 PE=1 SV=1
2	G5EFJ9	731	829	0.369	0.443	UN103_CAEEL Potassium voltage-gated channel unc-103 OS=Caenorhabditis elegans OX=6239 GN=unc-103 PE=1 SV=1
3	K4EHU2	568	956	0.296	0.308	K4EHU2_DANRE Potassium voltage-gated channel subfamily H member 1b OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
4	O08962	933	1163	0.455	0.389	KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus OX=10116 GN=Kcnh2 PE=1 SV=1
5	O18965	562	987	0.298	0.300	KCNH1_BOVIN Potassium voltage-gated channel subfamily H member 1 OS=Bos taurus OX=9913 GN=KCNH1 PE=2 SV=2
6	O35219	933	1162	0.456	0.390	KCNH2_MOUSE Potassium voltage-gated channel subfamily H member 2 OS=Mus musculus OX=10090 GN=Kcnh2 PE=1 SV=2
7	O54852	982	1195	0.530	0.441	KCNH7_RAT Potassium voltage-gated channel subfamily H member 7 OS=Rattus norvegicus OX=10116 GN=Kcnh7 PE=1 SV=1
8	O54853	1712	950	0.863	0.903	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
9	O95259	563	989	0.299	0.300	KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
10	Q02280	567	1174	0.307	0.260	KCNAE_DROME Potassium voltage-gated channel protein eag OS=Drosophila melanogaster OX=7227 GN=eag PE=1 SV=2
11	Q12809	938	1159	0.474	0.406	KCNH2_HUMAN Potassium voltage-gated channel subfamily H member 2 OS=Homo sapiens OX=9606 GN=KCNH2 PE=1 SV=1
12	Q60603	561	989	0.299	0.300	KCNH1_MOUSE Potassium voltage-gated channel subfamily H member 1 OS=Mus musculus OX=10090 GN=Kcnh1 PE=1 SV=2
13	Q63472	571	962	0.298	0.308	KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1
14	Q7JPB9	744	855	0.349	0.406	Q7JPB9_DROME GH12235p OS=Drosophila melanogaster OX=7227 GN=sei PE=2 SV=1
15	Q8JH78	917	1186	0.455	0.381	Q8JH78_DANRE Erg K+ channel OS=Danio rerio OX=7955 GN=erg PE=2 SV=1
16	Q8NCM2	558	988	0.292	0.294	KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3
17	Q96L42	587	1107	0.315	0.283	KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2
18	Q9EPI9	557	988	0.292	0.294	KCNH5_RAT Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus OX=10116 GN=Kcnh5 PE=2 SV=1
19	Q9H252	2054	994	1.000	1.000	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
20	Q9NS40	953	1196	0.457	0.380	KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens OX=9606 GN=KCNH7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	3.7e-09	47.9	Cyclic nucleotide-binding domain
2	PF00520 Ion_trans	7.9e-35	131.8	Ion transport protein
3	PF07885 Ion_trans_2	5e-08	44.1	Ion channel
4	PF08277 PAN_3	2.1e+02	13.2	PAN-like domain
5	PF00989 PAS	0.00098	30.5	PAS fold
6	PF08447 PAS_3	8.7	18.0	PAS fold
7	PF08448 PAS_4	11	17.7	PAS fold
8	PF13188 PAS_8	11	17.5	PAS domain
9	PF13426 PAS_9	6.7e-14	63.4	PAS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000463533

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277010	0.876	Sigma non-opioid intracellular receptor 1
2	9606.ENSP00000262186	0.861	Potassium voltage-gated channel subfamily H member 2
3	9606.ENSP00000328511	0.821	Potassium voltage-gated channel subfamily A member 4
4	9606.ENSP00000155840	0.815	Potassium voltage-gated channel subfamily KQT member 1
5	9606.ENSP00000373648	0.730	Potassium voltage-gated channel subfamily KQT member 3
6	9606.ENSP00000417052	0.720	3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
7	9606.ENSP00000352035	0.715	Potassium voltage-gated channel subfamily KQT member 2
8	9606.ENSP00000218176	0.714	Potassium voltage-gated channel subfamily D member 1
9	9606.ENSP00000345055	0.706	Potassium voltage-gated channel subfamily KQT member 5
10	9606.ENSP00000430846	0.705	Potassium voltage-gated channel subfamily B member 2
11	9606.ENSP00000312129	0.704	Potassium voltage-gated channel subfamily G member 4
12	9606.ENSP00000367323	0.696	Voltage-gated potassium channel subunit beta-2
13	9606.ENSP00000302719	0.695	Voltage-gated potassium channel subunit beta-3
14	9606.ENSP00000419952	0.692	Voltage-gated potassium channel subunit beta-1
15	9606.ENSP00000360806	0.686	Potassium voltage-gated channel subfamily B member 1
16	9606.ENSP00000335255	0.684	Angiopoietin-related protein 5
17	9606.ENSP00000435954	0.683	Potassium voltage-gated channel subfamily V member 1
18	9606.ENSP00000385968	0.680	Potassium voltage-gated channel subfamily S member 3
19	9606.ENSP00000262916	0.674	Potassium voltage-gated channel subfamily KQT member 4
20	9606.ENSP00000371985	0.673	Potassium voltage-gated channel subfamily A member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005249	1.000	voltage-gated potassium channel activity
GO:0005488	0.999	binding
GO:0005515	0.993	protein binding
GO:0022834	0.878	ligand-gated channel activity
GO:0015276	0.862	ligand-gated monoatomic ion channel activity
GO:0099094	0.800	ligand-gated monoatomic cation channel activity
GO:0005242	0.742	inward rectifier potassium channel activity
GO:0044877	0.521	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006812	0.995	monoatomic cation transport
GO:0006813	0.987	potassium ion transport
GO:0009987	0.795	cellular process
GO:0055085	0.488	transmembrane transport
GO:0065007	0.449	biological regulation
GO:0050789	0.356	regulation of biological process
GO:0050794	0.325	regulation of cellular process
GO:0098655	0.305	monoatomic cation transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.384	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]