StarFunc result for job id Q9H254

User Input

>input (2564 residues)
MAQVPGEVDNMEGLPAPNNNPAARWESPDRGWEREQPAASTAAASLFECSRIKALADERE
AVQKKTFTKWVNSHLARVGCHIGDLYVDLRDGFVLTRLLEVLSGEQLPRPTRGRMRIHSL
ENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRETR
SAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLTKSNANYN
LQRAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKV
LDQVLEVGKIIERYEELAAELLAWIHRTVGLISNQKFANSLSGVQQQLQAFTAYCTLEKP
VKFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWGELEKAEHEREAALRAE
LIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIAA
YEERVQGVAELAQALAAEGYYDIRRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQKV
FQEMVYMVDWMEEMQAQLLSRECGQHLVEADDLLQKHGLLEGDIAAQSERVEALNAAALR
FSQLQGYQPCDPQVICNRVNHVHGCLAELQEQAARRRAELEASRSLWALLQELEEAESWA
RDKERLLEAAGGGGAAGAAGAAGTAGGAHDLSSTARLLAQHKILQGELGGRRALLQQALR
CGEELVAAGGAVGPGADTVHLVGLAERAASARRRWQRLEEAAARRERRLQEARALHQFGA
DLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRGPVSGLRRQLATLG
GASGAGPLVVALQVRVVEAEQLFAEVTEVAALRRQWLRDALAVYRMFGEVHACELWIGEK
EQWLLSMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNHTVQELVEGGHPSSDEVRS
CQDHLNSRWNRIVELVEQRKEEMSAVLLVENHVLEVAEVRAQVREKRRAVESAPRAGGAL
QWRLSGLEAALQALEPRQAALLEEAALLAERFPAQAARLHQGAEELGAEWGALASAAQAC
GEAVAAAGRLQRFLHDLDAFLDWLVRAQEAAGGSEGPLPNSLEEADALLARHAALKEEVD
QREEDYARIVAASEALLAADGAELGPGLALDEWLPHLELGWHKLLGLWEARREALVQAHI
YQLFLRDLRQALVVLRNQEMALSGAELPGTVESVEEALKQHRDFLTTMELSQQKMQVAVQ
AAEGLLRQGNIYGEQAQEAVTRLLEKNQENQLRAQQWMQKLHDQLELQHFLRDCHELDGW
IHEKMLMARDGTREDNHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQEKPELAAS
VRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKKLLHMESQLQDVDPGG
DLATVNSQLKKLQSMESQVEEWYREVGELQAQTAALPLEPASKELVGERQNAVGERLVRL
LEPLQERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGNGLQAVQQHIKKNQGL
RREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERRQQVLDAA
FQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQL
SRQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVALEQQYWLYQLSRQVSELE
HWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASETGMAGRERLAAVNQMVDELIECGHT
AAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRL
TTPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEV
LQGWKELLSACEDARLHVSSTADALRFHSQVRDLLSWMDGIASQIGAADKPRDVSSVEVL
MNYHQGLKTELEARVPELTTCQELGRSLLLNKSAMADEIQAQLDKLGTRKEEVSEKWDRH
WEWLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAW
EERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPL
ARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPEIPGRVEPAALPAAPEDAAETPAT
PAAAEQVRPRPERQESADRAEELPRRRRPERQESVDQSEEAARRRRPERQESAEHEAAHS
LTLGRYEQMERRRERRERRLERQESSEQEMPIRGDLVKGKATLADIVEQLQEKEAGPGLP
AGPSLPQPRELPPGRLPNGLELPERTPRPDRPRARDRPKPRRRPRPREGGEGGGSRRSRS
APAQGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELGFYKDS
KGPASGSTHGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLE
AVASSVAEHAEIARWGQTLPTTSSTDEGNPKREGGDRRASGRRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E0AHA7	0.198	0.216	0.000	2326	0.365	0.402	E0AHA7.pdb.gz	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
2	AFDB:Q00963	0.163	0.180	0.000	2291	0.385	0.431	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
3	AFDB:Q01082	0.444	0.474	0.000	2364	0.471	0.511	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
4	AFDB:Q9H254	1.000	1.000	0.000	2564	1.000	1.000	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
5	AFDB:A4QPE4	0.189	0.454	1.146E-57	934	0.163	0.449	A4QPE4.pdb.gz	A4QPE4_HUMAN SPTBN2 protein OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=1
6	PDB:4d1eA	0.182	0.479	3.110E-29	859	0.096	0.285	4d1eA.pdb.gz
7	PDB:1sjjA	0.101	0.240	1.757E-25	863	0.104	0.308	1sjjA.pdb.gz
8	PDB:7sx8D	0.075	0.360	6.156E-6	448	0.023	0.132	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
9	AFDB:Q00IB7	0.041	0.072	9.983E-5	1433	0.046	0.082	Q00IB7.pdb.gz	PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio OX=7955 GN=plekhh1 PE=2 SV=1
10	PDB:6bcuA	0.042	0.046	1.359E-4	2204	0.102	0.119	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
11	PDB:7sqcR1	0.044	0.048	3.814E-4	2080	0.128	0.158	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:7jq9A	0.041	0.042	4.339E-4	2427	0.108	0.114	7jq9A.pdb.gz
13	PDB:7ni5A	0.057	0.055	6.961E-4	2791	0.093	0.085	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
14	PDB:7sglA	0.036	0.029	9.009E-4	3852	0.101	0.067	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
15	PDB:7mqaLM	0.042	0.048	1.326E-3	2041	0.100	0.126	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7mopA	0.043	0.044	1.575E-3	2445	0.109	0.115	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
17	AFDB:Q8NDX1	0.040	0.095	2.733E-3	1056	0.039	0.094	Q8NDX1.pdb.gz	PSD4_HUMAN PH and SEC7 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=PSD4 PE=1 SV=2
18	AFDB:Q8IVE3	0.035	0.060	2.853E-3	1493	0.046	0.078	Q8IVE3.pdb.gz	PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2
19	AFDB:Q4L180	0.031	0.064	3.109E-3	1135	0.067	0.152	Q4L180.pdb.gz	FIL1L_HUMAN Filamin A-interacting protein 1-like OS=Homo sapiens OX=9606 GN=FILIP1L PE=1 SV=2
20	AFDB:A0A140LH27	0.037	0.055	4.201E-3	1664	0.025	0.038	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZY6	2174	2152	0.428	0.510	A0A0G2JZY6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=2
2	A0A0G2K677	4521	2561	0.956	0.957	A0A0G2K677_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn4 PE=1 SV=1
3	A0A140UHX6	1947	2117	0.401	0.486	A0A140UHX6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=2
4	A0A8I6ASR7	4471	2542	0.949	0.957	A0A8I6ASR7_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn4 PE=3 SV=1
5	A0A8I6AWM3	1945	2329	0.401	0.442	A0A8I6AWM3_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1
6	A0A8I6G9M6	1940	2325	0.399	0.440	A0A8I6G9M6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1
7	A4QPE4	832	934	0.162	0.445	A4QPE4_HUMAN SPTBN2 protein OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=1
8	E0AHA7	1570	2326	0.342	0.377	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
9	E9PX29	4560	2561	0.957	0.958	E9PX29_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn4 PE=1 SV=1
10	E9PZC2	2161	1241	0.464	0.958	E9PZC2_MOUSE Spectrin beta, non-erythrocytic 4 OS=Mus musculus OX=10090 GN=Sptbn4 PE=1 SV=1
11	F1QQE5	1970	2357	0.398	0.433	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
12	F6W8M4	1880	2390	0.413	0.444	F6W8M4_MACMU Spectrin beta chain OS=Macaca mulatta OX=9544 GN=SPTBN2 PE=3 SV=3
13	G3V6S0	2196	2361	0.434	0.472	G3V6S0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=4
14	G5EG85	1586	2257	0.346	0.393	G5EG85_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
15	O15020	1882	2390	0.411	0.441	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
16	P11277	1955	2137	0.402	0.483	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
17	P15508	1926	2128	0.400	0.482	SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus OX=10090 GN=Sptb PE=1 SV=4
18	Q00963	1697	2291	0.359	0.402	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
19	Q01082	2197	2364	0.434	0.471	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
20	Q3UGZ4	1860	2388	0.409	0.439	Q3UGZ4_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10157 BORCS6	5.3	18.6	BLOC-1-related complex sub-unit 6 C-terminal helix
2	PF11971 CAMSAP_CH	0.00094	30.3	CAMSAP CH domain
3	PF00307 CH	9.2e-44	159.5	Calponin homology (CH) domain
4	PF18007 DUF5593	6e+02	12.5	Domain of unknown function (DUF5593)
5	PF19786 DUF6270	3.6e+02	12.4	Family of unknown function (DUF6270)
6	PF00169 PH	3.8e-11	54.8	PH domain
7	PF15413 PH_11	51	15.8	Pleckstrin homology domain
8	PF15410 PH_9	2e-14	65.2	Pleckstrin homology domain
9	PF00435 Spectrin	4.5e-202	668.4	Spectrin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263373

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280772	0.998	Ankyrin-3
2	9606.ENSP00000344786	0.979	Neurofascin
3	9606.ENSP00000349588	0.978	Ankyrin-2
4	9606.ENSP00000317790	0.923	Spectrin beta, non-erythrocytic 5
5	9606.ENSP00000432568	0.916	Spectrin beta chain, non-erythrocytic 2
6	9606.ENSP00000362680	0.908	Proto-oncogene tyrosine-protein kinase Src
7	9606.ENSP00000346534	0.906	Sodium channel protein type 8 subunit alpha
8	9606.ENSP00000256078	0.905	GTPase KRas
9	9606.ENSP00000358548	0.905	GTPase NRas
10	9606.ENSP00000407586	0.905	GTPase HRas
11	9606.ENSP00000368314	0.900	Neuronal cell adhesion molecule
12	9606.ENSP00000352035	0.886	Potassium voltage-gated channel subfamily KQT member 2
13	9606.ENSP00000364586	0.879	Sodium channel protein type 2 subunit alpha
14	9606.ENSP00000265709	0.871	Ankyrin-1
15	9606.ENSP00000361824	0.871	Spectrin alpha chain, non-erythrocytic 1
16	9606.ENSP00000373648	0.870	Potassium voltage-gated channel subfamily KQT member 3
17	9606.ENSP00000315775	0.853	Conserved oligomeric Golgi complex subunit 4
18	9606.ENSP00000338481	0.835	Band 4.1-like protein 2
19	9606.ENSP00000303540	0.810	Sodium channel protein type 1 subunit alpha
20	9606.ENSP00000357129	0.805	Spectrin alpha chain, erythrocytic 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0044877	0.999	protein-containing complex binding
GO:0030506	0.991	ankyrin binding
GO:0030507	0.988	spectrin binding
GO:0005198	0.946	structural molecule activity
GO:0005200	0.859	structural constituent of cytoskeleton
GO:0060090	0.847	molecular adaptor activity
GO:0030674	0.834	protein-macromolecule adaptor activity
GO:0019899	0.823	enzyme binding
GO:0043495	0.753	protein-membrane adaptor activity
GO:0008093	0.735	cytoskeletal anchor activity
GO:0019902	0.733	phosphatase binding
GO:0106006	0.519	cytoskeletal protein-membrane anchor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0021954	0.989	central nervous system neuron development
GO:0042551	0.989	neuron maturation
GO:0061337	0.987	cardiac conduction
GO:1903523	0.987	negative regulation of blood circulation
GO:0033135	0.987	regulation of peptidyl-serine phosphorylation
GO:0016043	0.986	cellular component organization
GO:0090659	0.986	walking behavior
GO:0030534	0.985	adult behavior
GO:0019226	0.985	transmission of nerve impulse
GO:0040018	0.985	positive regulation of multicellular organism growth
GO:0045161	0.974	neuronal ion channel clustering
GO:0051641	0.970	cellular localization
GO:0008344	0.968	adult locomotory behavior
GO:0010959	0.968	regulation of metal ion transport
GO:0021952	0.968	central nervous system projection neuron axonogenesis
GO:0002028	0.964	regulation of sodium ion transport
GO:0007628	0.961	adult walking behavior
GO:0045822	0.943	negative regulation of heart contraction
GO:0065008	0.928	regulation of biological quality
GO:0009566	0.917	fertilization
GO:0051234	0.900	establishment of localization
GO:0002027	0.852	regulation of heart rate
GO:0006810	0.825	transport
GO:0008104	0.789	protein localization
GO:0007605	0.689	sensory perception of sound
GO:0016192	0.556	vesicle-mediated transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.996	cellular anatomical entity
GO:0030054	0.993	cell junction
GO:0016020	0.990	membrane
GO:0005737	0.990	cytoplasm
GO:0043226	0.987	organelle
GO:0043229	0.981	intracellular organelle
GO:0071944	0.980	cell periphery
GO:0043232	0.974	intracellular non-membrane-bounded organelle
GO:0120025	0.945	plasma membrane bounded cell projection
GO:0043005	0.940	neuron projection
GO:0070161	0.933	anchoring junction
GO:0043025	0.930	neuronal cell body
GO:0005886	0.929	plasma membrane
GO:0043227	0.928	membrane-bounded organelle
GO:0044304	0.926	main axon
GO:0043194	0.922	axon initial segment
GO:0043203	0.922	axon hillock
GO:0070852	0.919	cell body fiber
GO:0005911	0.917	cell-cell junction
GO:0033268	0.914	node of Ranvier
GO:0005829	0.913	cytosol
GO:0044291	0.900	cell-cell contact zone
GO:0014704	0.893	intercalated disc
GO:0033270	0.855	paranode region of axon
GO:0043231	0.770	intracellular membrane-bounded organelle
GO:0005856	0.758	cytoskeleton
GO:0005634	0.605	nucleus
GO:0005576	0.535	extracellular region
GO:0032991	0.513	protein-containing complex
GO:0031982	0.463	vesicle
GO:0008091	0.372	spectrin
GO:0070062	0.370	extracellular exosome
GO:0070013	0.341	intracellular organelle lumen
GO:0031981	0.324	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]