StarFunc result for job id Q9H257

User Input

>input (536 residues)
MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRK
VGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLM
TEVMKLQKKVQDLTALLSSKDDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKE
ENYDLAMRLAHQSEEKGAALMRNRDLQLEIDQLKHSLMKAEDDCKVERKHTLKLRHAMEQ
RPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYIQVLEEDWRQALRDHQEQANT
IFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQMEEVAIERDQA
IATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLET
LVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDA
GLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H257	1.000	1.000	5.351E-65	536	1.000	1.000	Q9H257.pdb.gz	CARD9_HUMAN Caspase recruitment domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CARD9 PE=1 SV=2
2	AFDB:A2AIV8	0.571	0.571	4.888E-56	536	0.860	0.860	A2AIV8.pdb.gz	CARD9_MOUSE Caspase recruitment domain-containing protein 9 OS=Mus musculus OX=10090 GN=Card9 PE=1 SV=1
3	AFDB:Q8CIS0	0.449	0.229	9.219E-25	1159	0.379	0.175	Q8CIS0.pdb.gz	CAR11_MOUSE Caspase recruitment domain-containing protein 11 OS=Mus musculus OX=10090 GN=Card11 PE=1 SV=2
4	AFDB:Q5F3W0	0.261	0.134	3.242E-24	1170	0.371	0.170	Q5F3W0.pdb.gz	Q5F3W0_CHICK CARD domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_5k17 PE=2 SV=1
5	AFDB:Q9BWT7	0.259	0.146	2.154E-20	1032	0.336	0.174	Q9BWT7.pdb.gz	CAR10_HUMAN Caspase recruitment domain-containing protein 10 OS=Homo sapiens OX=9606 GN=CARD10 PE=1 SV=2
6	AFDB:A0A494C1N2	0.266	0.160	1.236E-14	1013	0.276	0.146	A0A494C1N2.pdb.gz	A0A494C1N2_HUMAN Caspase recruitment domain family member 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=1
7	AFDB:Q388T7	0.160	0.186	1.205E-2	438	0.166	0.203	Q388T7.pdb.gz	Q388T7_TRYB2 Kinesin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0360 PE=4 SV=1
8	PDB:5juyB	0.151	0.067	1.229E-2	1234	0.035	0.015	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
9	AFDB:Q9LD55	0.145	0.082	1.514E-2	987	0.194	0.105	Q9LD55.pdb.gz	EIF3A_ARATH Eukaryotic translation initiation factor 3 subunit A OS=Arabidopsis thaliana OX=3702 GN=TIF3A1 PE=1 SV=1
10	AFDB:Q86YF9	0.203	0.136	1.798E-2	867	0.162	0.100	Q86YF9.pdb.gz	DZIP1_HUMAN Cilium assembly protein DZIP1 OS=Homo sapiens OX=9606 GN=DZIP1 PE=1 SV=1
11	PDB:6mksA	0.148	0.797	2.441E-2	90	0.026	0.156	6mksA.pdb.gz
12	AFDB:P53565	0.106	0.042	3.184E-2	1504	0.179	0.064	P53565.pdb.gz	CUX1_RAT Homeobox protein cut-like 1 OS=Rattus norvegicus OX=10116 GN=Cux1 PE=1 SV=2
13	PDB:2vgqA	0.149	0.172	1.019E-1	461	0.032	0.037	2vgqA.pdb.gz	Crystal Structure of Human Ips-1 Caspase Activation Recruitment Domain
14	PDB:4irlB	0.151	0.173	4.252E-1	463	0.026	0.030	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.
15	PDB:6ki0A	0.133	0.155	1.002	459	0.026	0.031	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
16	PDB:4a2wA	0.146	0.117	1.260	678	0.026	0.021	4a2wA.pdb.gz
17	PDB:7mq8LJ	0.094	0.104	1.334	469	0.045	0.051	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:3klyC	0.083	0.132	1.412	259	0.024	0.050	3klyC.pdb.gz
19	PDB:7ajuUL	0.092	0.069	2.107	779	0.047	0.032	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:4bpmA	0.075	0.178	3.328	162	0.041	0.136	4bpmA.pdb.gz	Crystallizing Membrane Proteins in the Lipidic Mesophase. Experience with Human Prostaglandin E2 Synthase 1 and an Evolving Strategy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AIV8	0.0	916	536	0.860	0.860	CARD9_MOUSE Caspase recruitment domain-containing protein 9 OS=Mus musculus OX=10090 GN=Card9 PE=1 SV=1
2	Q9EPY0	0.0	921	536	0.862	0.862	CARD9_RAT Caspase recruitment domain-containing protein 9 OS=Rattus norvegicus OX=10116 GN=Card9 PE=1 SV=1
3	Q9H257	0.0	1083	536	1.000	1.000	CARD9_HUMAN Caspase recruitment domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CARD9 PE=1 SV=2
4	Q9BXL7	5.77e-110	355	1154	0.382	0.178	CAR11_HUMAN Caspase recruitment domain-containing protein 11 OS=Homo sapiens OX=9606 GN=CARD11 PE=1 SV=3
5	Q8CIS0	1.31e-109	354	1159	0.382	0.177	CAR11_MOUSE Caspase recruitment domain-containing protein 11 OS=Mus musculus OX=10090 GN=Card11 PE=1 SV=2
6	Q5F3W0	4.73e-106	345	1170	0.379	0.174	Q5F3W0_CHICK CARD domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_5k17 PE=2 SV=1
7	P58660	2.00e-76	262	1021	0.319	0.167	CAR10_MOUSE Caspase recruitment domain-containing protein 10 OS=Mus musculus OX=10090 GN=Card10 PE=1 SV=1
8	Q17RA1	1.26e-73	254	1030	0.341	0.178	Q17RA1_HUMAN Caspase recruitment domain family, member 10 OS=Homo sapiens OX=9606 GN=CARD10 PE=1 SV=1
9	Q9BWT7	2.42e-73	254	1032	0.341	0.177	CAR10_HUMAN Caspase recruitment domain-containing protein 10 OS=Homo sapiens OX=9606 GN=CARD10 PE=1 SV=2
10	Q9BXL6	3.42e-36	146	1004	0.250	0.133	CAR14_HUMAN Caspase recruitment domain-containing protein 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=2
11	A0A494C1N2	4.14e-36	145	1013	0.250	0.132	A0A494C1N2_HUMAN Caspase recruitment domain family member 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=1
12	Q9BQS8	0.38	36.2	1478	0.067	0.024	FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3
13	E9Q0F0	0.60	35.4	1068	0.093	0.047	E9Q0F0_MOUSE Keratin 78 OS=Mus musculus OX=10090 GN=Krt78 PE=1 SV=1
14	Q6IFT3	0.60	35.4	800	0.093	0.062	Q6IFT3_MOUSE Keratin Kb40 OS=Mus musculus OX=10090 GN=Krt78 PE=2 SV=1
15	Q8N6L0	0.94	34.7	562	0.056	0.053	KASH5_HUMAN Protein KASH5 OS=Homo sapiens OX=9606 GN=KASH5 PE=1 SV=2
16	Q8IDX6	1.5	34.3	3130	0.058	0.010	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
17	P24043	1.7	34.3	3122	0.104	0.018	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4
18	F1MF50	2.2	33.9	1356	0.151	0.060	F1MF50_BOVIN Rho-associated protein kinase OS=Bos taurus OX=9913 GN=ROCK1 PE=3 SV=3
19	Q0VDN0	2.6	33.1	513	0.101	0.105	Q0VDN0_MOUSE Krt78 protein (Fragment) OS=Mus musculus OX=10090 GN=Krt78 PE=2 SV=1
20	Q0VDM9	3.2	33.1	492	0.101	0.110	Q0VDM9_MOUSE Krt78 protein (Fragment) OS=Mus musculus OX=10090 GN=Krt78 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	1.1e-15	68.7	Caspase recruitment domain
2	PF16739 CARD_2	2.1	19.7	Caspase recruitment domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360797

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359612	0.999	B-cell lymphoma/leukemia 10
2	9606.ENSP00000319279	0.997	Mucosa-associated lymphoid tissue lymphoma translocation protein 1
3	9606.ENSP00000364907	0.997	Tyrosine-protein kinase SYK
4	9606.ENSP00000300589	0.994	Nucleotide-binding oligomerization domain-containing protein 2
5	9606.ENSP00000351273	0.980	Caspase-8
6	9606.ENSP00000302569	0.949	C-type lectin domain family 7 member A
7	9606.ENSP00000378217	0.946	Protein kinase C delta type
8	9606.ENSP00000220751	0.935	Receptor-interacting serine/threonine-protein kinase 2
9	9606.ENSP00000483825	0.907	NF-kappa-B essential modulator
10	9606.ENSP00000228945	0.902	Rho GDP-dissociation inhibitor 2
11	9606.ENSP00000222823	0.894	Nucleotide-binding oligomerization domain-containing protein 1
12	9606.ENSP00000471896	0.871	Interferon regulatory factor 3
13	9606.ENSP00000371505	0.863	C-type lectin domain family 6 member A
14	9606.ENSP00000430684	0.862	Inhibitor of nuclear factor kappa-B kinase subunit beta
15	9606.ENSP00000359424	0.850	Inhibitor of nuclear factor kappa-B kinase subunit alpha
16	9606.ENSP00000291416	0.843	E3 ubiquitin-protein ligase TRIM62
17	9606.ENSP00000299663	0.830	C-type lectin domain family 4 member E
18	9606.ENSP00000263025	0.822	Mitogen-activated protein kinase 3
19	9606.ENSP00000378974	0.820	Mitogen-activated protein kinase 8
20	9606.ENSP00000215832	0.808	Mitogen-activated protein kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	1.000	protein domain specific binding
GO:0042802	0.978	identical protein binding
GO:0050700	0.966	CARD domain binding
GO:0046983	0.960	protein dimerization activity
GO:0042803	0.928	protein homodimerization activity
GO:0043621	0.824	protein self-association

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0048518	0.989	positive regulation of biological process
GO:0009987	0.986	cellular process
GO:0048583	0.980	regulation of response to stimulus
GO:0051240	0.980	positive regulation of multicellular organismal process
GO:0001817	0.976	regulation of cytokine production
GO:0048522	0.974	positive regulation of cellular process
GO:0001819	0.973	positive regulation of cytokine production
GO:0051716	0.970	cellular response to stimulus
GO:0048584	0.965	positive regulation of response to stimulus
GO:0002376	0.962	immune system process
GO:0007165	0.962	signal transduction
GO:0023051	0.959	regulation of signaling
GO:0010646	0.959	regulation of cell communication
GO:0006950	0.958	response to stress
GO:0002682	0.950	regulation of immune system process
GO:0009966	0.941	regulation of signal transduction
GO:0050778	0.936	positive regulation of immune response
GO:0051091	0.934	positive regulation of DNA-binding transcription factor activity
GO:0043408	0.930	regulation of MAPK cascade
GO:1902533	0.912	positive regulation of intracellular signal transduction
GO:0070302	0.909	regulation of stress-activated protein kinase signaling cascade
GO:0044419	0.907	biological process involved in interspecies interaction between organisms
GO:0009605	0.905	response to external stimulus
GO:0045087	0.899	innate immune response
GO:0051092	0.886	positive regulation of NF-kappaB transcription factor activity
GO:0051173	0.861	positive regulation of nitrogen compound metabolic process
GO:0002460	0.842	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0046328	0.801	regulation of JNK cascade
GO:0043410	0.773	positive regulation of MAPK cascade
GO:0042221	0.769	response to chemical
GO:0070304	0.746	positive regulation of stress-activated protein kinase signaling cascade
GO:0046330	0.739	positive regulation of JNK cascade
GO:0032501	0.738	multicellular organismal process
GO:0002449	0.726	lymphocyte mediated immunity
GO:0002819	0.706	regulation of adaptive immune response
GO:0010033	0.705	response to organic substance
GO:0035556	0.675	intracellular signal transduction
GO:0051246	0.643	regulation of protein metabolic process
GO:0050790	0.638	regulation of catalytic activity
GO:0043085	0.610	positive regulation of catalytic activity
GO:0019724	0.601	B cell mediated immunity
GO:0051247	0.590	positive regulation of protein metabolic process
GO:0002821	0.571	positive regulation of adaptive immune response
GO:0031349	0.546	positive regulation of defense response
GO:0032675	0.515	regulation of interleukin-6 production
GO:0043122	0.500	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032103	0.485	positive regulation of response to external stimulus
GO:0032755	0.454	positive regulation of interleukin-6 production
GO:0031325	0.443	positive regulation of cellular metabolic process
GO:0016064	0.426	immunoglobulin mediated immune response
GO:0002822	0.384	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0048519	0.379	negative regulation of biological process
GO:0070887	0.379	cellular response to chemical stimulus
GO:0045089	0.375	positive regulation of innate immune response
GO:0008152	0.356	metabolic process
GO:0071310	0.348	cellular response to organic substance
GO:0043123	0.348	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0002824	0.326	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0007166	0.323	cell surface receptor signaling pathway
GO:0048523	0.300	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0005886	0.988	plasma membrane
GO:0043226	0.708	organelle
GO:0043229	0.688	intracellular organelle
GO:0043227	0.595	membrane-bounded organelle
GO:0043231	0.478	intracellular membrane-bounded organelle
GO:0140535	0.398	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]