StarFunc result for job id Q9H267

User Input

>input (617 residues)
MAFPHRPDAPELPDFSMLKRLARDQLIYLLEQLPGKKDLFIEADLMSPLDRIANVSILKQ
HEVDKLYKVENKPALSSNEQLCFLVRPRIKNMRYIASLVNADKLAGRTRKYKVIFSPQKF
YACEMVLEEEGIYGDVSCDEWAFSLLPLDVDLLSMELPEFFRDYFLEGDQRWINTVAQAL
HLLSTLYGPFPNCYGIGRCAKMAYELWRNLEEEEDGETKGRRPEIGHIFLLDRDVDFVTA
LCSQVVYEGLVDDTFRIKCGSVDFGPEVTSSDKSLKVLLNAEDKVFNEIRNEHFSNVFGF
LSQKARNLQAQYDRRRGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACESIMKKKTKQDF
QELIKTEHALLEGFNIRESTSYIEEHIDRQVSPIESLRLMCLLSITENGLIPKDYRSLKT
QYLQSYGPEHLLTFSNLRRAGLLTEQAPGDTLTAVESKVSKLVTDKAAGKITDAFSSLAK
RSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFGGAYVPLSCRIIEQVLERRSWQGLDEV
VRLLNCSDFAFTDMTKEDKASSESLRLILVVFLGGCTFSEISALRFLGREKGYRFIFLTT
AVTNSARLMEAMSEVKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59016	0.995	0.995	0.000	617	0.972	0.972	P59016.pdb.gz	VP33B_MOUSE Vacuolar protein sorting-associated protein 33B OS=Mus musculus OX=10090 GN=Vps33b PE=1 SV=1
2	AFDB:Q58EN8	0.935	0.935	6.513E-86	617	0.737	0.737	Q58EN8.pdb.gz	VP33B_DANRE Vacuolar protein sorting-associated protein 33B OS=Danio rerio OX=7955 GN=vps33b PE=2 SV=1
3	AFDB:F4JE40	0.856	0.868	2.160E-46	608	0.305	0.309	F4JE40.pdb.gz	F4JE40_ARATH Sec1/munc18-like (SM) proteins superfamily OS=Arabidopsis thaliana OX=3702 GN=ATVPS33 PE=1 SV=1
4	AFDB:Q9D2N9	0.870	0.897	6.200E-46	598	0.313	0.323	Q9D2N9.pdb.gz	VP33A_MOUSE Vacuolar protein sorting-associated protein 33A OS=Mus musculus OX=10090 GN=Vps33a PE=1 SV=2
5	AFDB:G0SCM5	0.847	0.656	2.963E-44	806	0.301	0.231	G0SCM5.pdb.gz	G0SCM5_CHATD Small conjugating protein ligase-like protein OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0057760 PE=1 SV=1
6	AFDB:A4V4S5	0.862	0.862	1.271E-43	617	0.277	0.277	A4V4S5.pdb.gz	A4V4S5_DROME Carnation, isoform B OS=Drosophila melanogaster OX=7227 GN=car PE=1 SV=1
7	PDB:4bx9B	0.863	0.915	4.160E-43	581	0.318	0.337	4bx9B.pdb.gz
8	AFDB:Q18891	0.827	0.827	2.607E-41	617	0.263	0.263	Q18891.pdb.gz	VP33B_CAEEL Vacuolar protein sorting-associated protein 33B OS=Caenorhabditis elegans OX=6239 GN=vps-33.2 PE=1 SV=3
9	AFDB:Q9P7V6	0.832	0.865	4.530E-41	592	0.272	0.284	Q9P7V6.pdb.gz	VPS33_SCHPO Vacuolar protein sorting-associated protein 33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps33 PE=3 SV=1
10	AFDB:Q9VBR1	0.800	0.772	4.047E-36	640	0.204	0.197	Q9VBR1.pdb.gz	Q9VBR1_DROME Vacuolar protein sorting 33B OS=Drosophila melanogaster OX=7227 GN=Vps33B PE=3 SV=1
11	AFDB:P34260	0.737	0.753	1.964E-32	603	0.214	0.219	P34260.pdb.gz	VP33A_CAEEL Vacuolar protein sorting-associated protein 33A OS=Caenorhabditis elegans OX=6239 GN=vps-33.1 PE=1 SV=4
12	PDB:4ccaA	0.599	0.666	4.410E-22	542	0.144	0.164	4ccaA.pdb.gz
13	PDB:7zu0D	0.664	0.684	9.367E-22	597	0.203	0.209	7zu0D.pdb.gz
14	PDB:7xsjA	0.581	0.629	3.126E-21	561	0.146	0.160	7xsjA.pdb.gz	A non-canonical target-binding site in Munc18-1 domain 3b for assembling the Mint1-Munc18-1-syntaxin-1 complex.
15	PDB:3pujB	0.537	0.608	2.596E-19	534	0.143	0.165	3pujB.pdb.gz	Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation
16	PDB:3pukA	0.560	0.612	4.988E-19	552	0.123	0.138	3pukA.pdb.gz	Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation
17	PDB:1mqsA	0.530	0.552	1.432E-18	588	0.139	0.146	1mqsA.pdb.gz	Structural basis for the Golgi membrane recruitment of Sly1p by Sed5p
18	PDB:6lpcB	0.523	0.674	7.054E-13	467	0.133	0.176	6lpcB.pdb.gz
19	PDB:2dm6B	0.127	0.209	8.061E-2	333	0.042	0.078	2dm6B.pdb.gz	Crystal structure of anti-configuration of indomethacin and leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase complex reveals the structural basis of broad spectrum indomethacin efficacy
20	PDB:2o2eB	0.095	0.137	8.476E-2	316	0.036	0.070	2o2eB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59016	0.0	1241	617	0.972	0.972	VP33B_MOUSE Vacuolar protein sorting-associated protein 33B OS=Mus musculus OX=10090 GN=Vps33b PE=1 SV=1
2	Q58EN8	0.0	958	617	0.737	0.737	VP33B_DANRE Vacuolar protein sorting-associated protein 33B OS=Danio rerio OX=7955 GN=vps33b PE=2 SV=1
3	Q63616	0.0	1233	617	0.966	0.966	VP33B_RAT Vacuolar protein sorting-associated protein 33B OS=Rattus norvegicus OX=10116 GN=Vps33b PE=2 SV=1
4	Q9H267	0.0	1273	617	1.000	1.000	VP33B_HUMAN Vacuolar protein sorting-associated protein 33B OS=Homo sapiens OX=9606 GN=VPS33B PE=1 SV=2
5	Q63615	1.25e-91	296	597	0.323	0.333	VP33A_RAT Vacuolar protein sorting-associated protein 33A OS=Rattus norvegicus OX=10116 GN=Vps33a PE=1 SV=1
6	Q96AX1	3.58e-91	295	596	0.319	0.331	VP33A_HUMAN Vacuolar protein sorting-associated protein 33A OS=Homo sapiens OX=9606 GN=VPS33A PE=1 SV=1
7	Q9D2N9	2.00e-90	293	598	0.323	0.333	VP33A_MOUSE Vacuolar protein sorting-associated protein 33A OS=Mus musculus OX=10090 GN=Vps33a PE=1 SV=2
8	B2RDH6	6.02e-90	292	596	0.318	0.329	B2RDH6_HUMAN cDNA, FLJ96613, highly similar to Homo sapiens vacuolar protein sorting 33A (yeast) (VPS33A), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
9	Q94KJ7	4.14e-82	271	592	0.303	0.316	VPS33_ARATH Vacuolar protein-sorting-associated protein 33 homolog OS=Arabidopsis thaliana OX=3702 GN=VPS33 PE=1 SV=1
10	G0SCM5	4.58e-79	268	806	0.316	0.242	G0SCM5_CHATD Small conjugating protein ligase-like protein OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0057760 PE=1 SV=1
11	F4JE40	8.44e-78	260	608	0.303	0.308	F4JE40_ARATH Sec1/munc18-like (SM) proteins superfamily OS=Arabidopsis thaliana OX=3702 GN=ATVPS33 PE=1 SV=1
12	Q18891	5.72e-71	242	617	0.284	0.284	VP33B_CAEEL Vacuolar protein sorting-associated protein 33B OS=Caenorhabditis elegans OX=6239 GN=vps-33.2 PE=1 SV=3
13	A4V4S5	1.31e-68	236	617	0.287	0.287	A4V4S5_DROME Carnation, isoform B OS=Drosophila melanogaster OX=7227 GN=car PE=1 SV=1
14	Q9Y1I2	1.31e-68	236	617	0.287	0.287	VP33A_DROME Vacuolar protein sorting-associated protein 33A OS=Drosophila melanogaster OX=7227 GN=car PE=1 SV=1
15	M9PF72	2.19e-68	236	639	0.287	0.277	M9PF72_DROME Carnation, isoform C OS=Drosophila melanogaster OX=7227 GN=car PE=1 SV=1
16	Q9P7V6	2.02e-57	205	592	0.288	0.301	VPS33_SCHPO Vacuolar protein sorting-associated protein 33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps33 PE=3 SV=1
17	Q9H6C4	1.17e-31	125	253	0.147	0.360	Q9H6C4_HUMAN cDNA: FLJ22395 fis, clone HRC07889 OS=Homo sapiens OX=9606 PE=2 SV=1
18	Q9VBR1	9.33e-30	126	640	0.217	0.209	Q9VBR1_DROME Vacuolar protein sorting 33B OS=Drosophila melanogaster OX=7227 GN=Vps33B PE=3 SV=1
19	P20795	9.47e-24	108	691	0.193	0.172	VPS33_YEAST Vacuolar protein sorting-associated protein 33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS33 PE=1 SV=1
20	P34260	2.20e-21	100	603	0.243	0.249	VP33A_CAEEL Vacuolar protein sorting-associated protein 33A OS=Caenorhabditis elegans OX=6239 GN=vps-33.1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00995 Sec1	5.6e-106	367.7	Sec1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327650

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000452181	0.999	Spermatogenesis-defective protein 39 homolog
2	9606.ENSP00000369810	0.997	Vacuolar protein sorting-associated protein 16 homolog
3	9606.ENSP00000309457	0.996	Vacuolar protein sorting-associated protein 41 homolog
4	9606.ENSP00000220509	0.995	Vacuolar protein sorting-associated protein 18 homolog
5	9606.ENSP00000481126	0.995	Vacuolar protein sorting-associated protein 11 homolog
6	9606.ENSP00000335193	0.988	Vam6/Vps39-like protein
7	9606.ENSP00000404704	0.980	Vacuolar protein sorting-associated protein 8 homolog
8	9606.ENSP00000267199	0.949	Vacuolar protein sorting-associated protein 33A
9	9606.ENSP00000377027	0.913	Transforming growth factor-beta receptor-associated protein 1
10	9606.ENSP00000356918	0.898	Syntaxin-7
11	9606.ENSP00000363054	0.889	Syntaxin-12
12	9606.ENSP00000305255	0.860	Syntaxin-8
13	9606.ENSP00000223369	0.850	Synaptobrevin homolog YKT6
14	9606.ENSP00000265062	0.837	Ras-related protein Rab-7a
15	9606.ENSP00000479762	0.834	Ras-related protein Rab-7b
16	9606.ENSP00000469421	0.769	Carcinoembryonic antigen-related cell adhesion molecule 5 isoform 3D
17	9606.ENSP00000261890	0.767	Ras-related protein Rab-11A
18	9606.ENSP00000259400	0.755	Syntaxin-17
19	9606.ENSP00000450731	0.753	Vesicle transport through interaction with t-SNAREs homolog 1B
20	9606.ENSP00000376792	0.744	Vesicle transport through interaction with t-SNAREs homolog 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006810	0.993	transport
GO:0016043	0.986	cellular component organization
GO:0006996	0.974	organelle organization
GO:0008152	0.968	metabolic process
GO:0016050	0.954	vesicle organization
GO:0051641	0.935	cellular localization
GO:0071704	0.934	organic substance metabolic process
GO:0044238	0.929	primary metabolic process
GO:0006807	0.909	nitrogen compound metabolic process
GO:1901564	0.898	organonitrogen compound metabolic process
GO:0043170	0.820	macromolecule metabolic process
GO:0019538	0.808	protein metabolic process
GO:0016192	0.770	vesicle-mediated transport
GO:0018126	0.684	protein hydroxylation
GO:0032963	0.649	collagen metabolic process
GO:0065007	0.600	biological regulation
GO:0033036	0.594	macromolecule localization
GO:0051649	0.589	establishment of localization in cell
GO:0018193	0.554	peptidyl-amino acid modification
GO:0010256	0.539	endomembrane system organization
GO:0070727	0.539	cellular macromolecule localization
GO:0050794	0.526	regulation of cellular process
GO:0008104	0.519	protein localization
GO:0046907	0.432	intracellular transport
GO:0015031	0.370	protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0031410	0.998	cytoplasmic vesicle
GO:0016020	0.993	membrane
GO:0005829	0.989	cytosol
GO:0099503	0.988	secretory vesicle
GO:0005794	0.963	Golgi apparatus
GO:0030659	0.956	cytoplasmic vesicle membrane
GO:0032991	0.951	protein-containing complex
GO:0098588	0.906	bounding membrane of organelle
GO:0005764	0.892	lysosome
GO:0030141	0.869	secretory granule
GO:0005770	0.868	late endosome
GO:0010008	0.857	endosome membrane
GO:0098796	0.830	membrane protein complex
GO:0005774	0.634	vacuolar membrane
GO:0048471	0.595	perinuclear region of cytoplasm
GO:0098852	0.580	lytic vacuole membrane
GO:0099023	0.521	vesicle tethering complex
GO:0030135	0.516	coated vesicle
GO:0005765	0.515	lysosomal membrane
GO:0005769	0.485	early endosome
GO:0030136	0.477	clathrin-coated vesicle
GO:0030054	0.429	cell junction
GO:0070013	0.418	intracellular organelle lumen
GO:0030133	0.381	transport vesicle
GO:0030897	0.347	HOPS complex
GO:0045202	0.328	synapse
GO:0098793	0.308	presynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]