StarFunc result for job id Q9H293

User Input

>input (177 residues)
MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVP
PLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQT
GSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H293	1.000	1.000	2.560E-34	177	1.000	1.000	Q9H293.pdb.gz	IL25_HUMAN Interleukin-25 OS=Homo sapiens OX=9606 GN=IL25 PE=1 SV=1
2	AFDB:D3ZLB1	0.662	0.691	3.867E-21	169	0.650	0.680	D3ZLB1.pdb.gz	D3ZLB1_RAT Interleukin 25 OS=Rattus norvegicus OX=10116 GN=Il25 PE=3 SV=1
3	AFDB:Q8K4C5	0.494	0.453	5.659E-10	194	0.226	0.206	Q8K4C5.pdb.gz	IL17C_MOUSE Interleukin-17C OS=Mus musculus OX=10090 GN=Il17c PE=1 SV=1
4	AFDB:Q9P0M4	0.478	0.433	1.726E-9	197	0.237	0.213	Q9P0M4.pdb.gz	IL17C_HUMAN Interleukin-17C OS=Homo sapiens OX=9606 GN=IL17C PE=1 SV=1
5	AFDB:Q8TAD2	0.494	0.436	5.922E-9	202	0.226	0.198	Q8TAD2.pdb.gz	IL17D_HUMAN Interleukin-17D OS=Homo sapiens OX=9606 GN=IL17D PE=2 SV=1
6	AFDB:Q5TKT0	0.468	0.510	9.471E-9	162	0.232	0.253	Q5TKT0.pdb.gz	Q5TKT0_DANRE Interleukin 17_5 OS=Danio rerio OX=7955 GN=f3 PE=2 SV=1
7	AFDB:Q62386	0.470	0.524	1.703E-8	158	0.198	0.222	Q62386.pdb.gz	IL17_MOUSE Interleukin-17A OS=Mus musculus OX=10090 GN=Il17a PE=1 SV=1
8	AFDB:Q16552	0.466	0.530	1.806E-8	155	0.232	0.265	Q16552.pdb.gz	IL17_HUMAN Interleukin-17A OS=Homo sapiens OX=9606 GN=IL17A PE=1 SV=1
9	AFDB:A0A2R8Q9D6	0.489	0.508	1.915E-8	170	0.226	0.235	A0A2R8Q9D6.pdb.gz
10	AFDB:Q96PD4	0.471	0.508	2.422E-8	163	0.232	0.252	Q96PD4.pdb.gz	IL17F_HUMAN Interleukin-17F OS=Homo sapiens OX=9606 GN=IL17F PE=1 SV=3
11	PDB:4qhuC	0.428	0.617	8.157E-8	119	0.215	0.319	4qhuC.pdb.gz
12	PDB:6hgoC	0.446	0.611	1.230E-7	127	0.203	0.283	6hgoC.pdb.gz
13	PDB:7uwmA	0.404	0.628	3.146E-7	109	0.153	0.248	7uwmA.pdb.gz
14	PDB:7uwnE	0.337	0.607	8.308E-5	93	0.158	0.301	7uwnE.pdb.gz
15	PDB:1m4uA	0.311	0.282	5.058E-3	199	0.175	0.156	1m4uA.pdb.gz
16	PDB:7ag0A	0.301	0.368	4.184E-2	140	0.130	0.164	7ag0A.pdb.gz
17	PDB:1wq8A	0.250	0.359	4.990E-2	100	0.090	0.160	1wq8A.pdb.gz
18	PDB:2k8pA	0.235	0.223	1.009E-1	189	0.124	0.116	2k8pA.pdb.gz
19	PDB:4my2A	0.221	0.099	4.129E-1	474	0.096	0.036	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
20	PDB:6n7rK	0.118	0.137	5.872E-1	124	0.068	0.097	6n7rK.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H293	1.38e-130	365	177	1.000	1.000	IL25_HUMAN Interleukin-25 OS=Homo sapiens OX=9606 GN=IL25 PE=1 SV=1
2	Q8VHH8	1.43e-87	256	169	0.718	0.751	IL25_MOUSE Interleukin-25 OS=Mus musculus OX=10090 GN=Il25 PE=2 SV=1
3	D3ZLB1	1.95e-87	255	169	0.718	0.751	D3ZLB1_RAT Interleukin 25 OS=Rattus norvegicus OX=10116 GN=Il25 PE=3 SV=1
4	Q9P0M4	4.19e-11	60.8	197	0.198	0.178	IL17C_HUMAN Interleukin-17C OS=Homo sapiens OX=9606 GN=IL17C PE=1 SV=1
5	Q8K4C5	4.24e-09	55.5	194	0.203	0.186	IL17C_MOUSE Interleukin-17C OS=Mus musculus OX=10090 GN=Il17c PE=1 SV=1
6	Q7TNI7	2.05e-06	47.8	161	0.164	0.180	IL17F_MOUSE Interleukin-17F OS=Mus musculus OX=10090 GN=Il17f PE=1 SV=1
7	Q9QXT6	3.41e-06	47.4	180	0.164	0.161	IL17B_MOUSE Interleukin-17B OS=Mus musculus OX=10090 GN=Il17b PE=2 SV=1
8	Q70I21	1.15e-05	45.4	146	0.153	0.185	Q70I21_ONCMY Interleukin 17 isoform A OS=Oncorhynchus mykiss OX=8022 GN=il-17A PE=2 SV=1
9	Q96PD4	1.65e-05	45.1	163	0.175	0.190	IL17F_HUMAN Interleukin-17F OS=Homo sapiens OX=9606 GN=IL17F PE=1 SV=3
10	Q5TKT1	6.84e-05	43.9	212	0.220	0.184	Q5TKT1_DANRE Interleukin 17_4 OS=Danio rerio OX=7955 GN=zgc:194303 PE=2 SV=1
11	Q5TKT0	6.85e-05	43.5	162	0.153	0.167	Q5TKT0_DANRE Interleukin 17_5 OS=Danio rerio OX=7955 GN=f3 PE=2 SV=1
12	Q9UHF5	7.09e-05	43.5	180	0.102	0.100	IL17B_HUMAN Interleukin-17B OS=Homo sapiens OX=9606 GN=IL17B PE=2 SV=1
13	Q8TAD2	1.15e-04	43.1	202	0.164	0.144	IL17D_HUMAN Interleukin-17D OS=Homo sapiens OX=9606 GN=IL17D PE=2 SV=1
14	Q16552	0.044	35.4	155	0.153	0.174	IL17_HUMAN Interleukin-17A OS=Homo sapiens OX=9606 GN=IL17A PE=1 SV=1
15	Q62386	0.43	32.3	158	0.136	0.152	IL17_MOUSE Interleukin-17A OS=Mus musculus OX=10090 GN=Il17a PE=1 SV=1
16	Q61453	0.50	32.3	150	0.147	0.173	IL17_RAT Interleukin-17A OS=Rattus norvegicus OX=10116 GN=Il17a PE=2 SV=1
17	Q6UWV6	1.9	31.2	458	0.113	0.044	ENPP7_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Homo sapiens OX=9606 GN=ENPP7 PE=1 SV=4
18	Q22687	3.3	30.0	221	0.079	0.063	IL171_CAEEL Interleukin cytokine-related protein 17.1 OS=Caenorhabditis elegans OX=6239 GN=ilc-17.1 PE=1 SV=2
19	Q3TIW9	4.4	30.0	439	0.107	0.043	ENPP7_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Mus musculus OX=10090 GN=Enpp7 PE=1 SV=1
20	Q3TDN0	7.5	29.6	1521	0.124	0.014	DISP1_MOUSE Protein dispatched homolog 1 OS=Mus musculus OX=10090 GN=Disp1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06083 IL17	3e-16	70.9	Interleukin-17

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328111

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288167	0.998	Interleukin-17 receptor B
2	9606.ENSP00000320936	0.995	Interleukin-17 receptor A
3	9606.ENSP00000261796	0.892	Interleukin-17B
4	9606.ENSP00000302924	0.861	Interleukin-17D
5	9606.ENSP00000337432	0.842	Interleukin-17F
6	9606.ENSP00000373325	0.795	Interleukin-17 receptor E
7	9606.ENSP00000295981	0.764	Interleukin-17 receptor C
8	9606.ENSP00000344192	0.758	Interleukin-17A
9	9606.ENSP00000296318	0.698	Interleukin-17 receptor D
10	9606.ENSP00000304915	0.613	Interleukin-13
11	9606.ENSP00000231454	0.603	Interleukin-5
12	9606.ENSP00000339804	0.601	Thymic stromal lymphopoietin
13	9606.ENSP00000370842	0.601	Interleukin-33
14	9606.ENSP00000302234	0.574	Eotaxin
15	9606.ENSP00000231449	0.566	Interleukin-4
16	9606.ENSP00000385675	0.556	Interleukin-6
17	9606.ENSP00000357750	0.527	Adapter protein CIKS
18	9606.ENSP00000011653	0.520	T-cell surface glycoprotein CD4
19	9606.ENSP00000442424	0.518	Interleukin-22
20	9606.ENSP00000398698	0.510	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005126	1.000	cytokine receptor binding
GO:0048018	0.981	receptor ligand activity
GO:0005125	0.974	cytokine activity
GO:0030380	0.673	interleukin-17E receptor binding
GO:0042802	0.346	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.982	cellular process
GO:0050789	0.979	regulation of biological process
GO:0006950	0.970	response to stress
GO:0006954	0.963	inflammatory response
GO:0048518	0.959	positive regulation of biological process
GO:0050794	0.942	regulation of cellular process
GO:0002376	0.937	immune system process
GO:0060255	0.935	regulation of macromolecule metabolic process
GO:0010468	0.921	regulation of gene expression
GO:0010604	0.919	positive regulation of macromolecule metabolic process
GO:0048522	0.867	positive regulation of cellular process
GO:0009605	0.773	response to external stimulus
GO:0051171	0.720	regulation of nitrogen compound metabolic process
GO:0009607	0.718	response to biotic stimulus
GO:0080090	0.716	regulation of primary metabolic process
GO:0051707	0.712	response to other organism
GO:0051716	0.701	cellular response to stimulus
GO:0006955	0.664	immune response
GO:0048856	0.568	anatomical structure development
GO:0051173	0.547	positive regulation of nitrogen compound metabolic process
GO:0031323	0.488	regulation of cellular metabolic process
GO:0051239	0.483	regulation of multicellular organismal process
GO:0031325	0.481	positive regulation of cellular metabolic process
GO:0019219	0.459	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.457	regulation of cellular biosynthetic process
GO:0010556	0.455	regulation of macromolecule biosynthetic process
GO:2001141	0.452	regulation of RNA biosynthetic process
GO:0031328	0.440	positive regulation of cellular biosynthetic process
GO:0042221	0.427	response to chemical
GO:0006355	0.427	regulation of DNA-templated transcription
GO:0001817	0.410	regulation of cytokine production
GO:0001819	0.348	positive regulation of cytokine production
GO:0007154	0.333	cell communication
GO:0051254	0.325	positive regulation of RNA metabolic process
GO:0045893	0.313	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005615	0.817	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]