StarFunc result for job id Q9H295

User Input

>input (470 residues)
MGIWTSGTDIFLSLWEIYVSPRSPGWMDFIQHLGVCCLVALISVGLLSVAACWFLPSIIA
AAASWIITCVLLCCSKHARCFILLVFLSCGLREGRNALIAAGTGIVILGHVENIFHNFKG
LLDGMTCNLRAKSFSIHFPLLKKYIEAIQWIYGLATPLSVFDDLVSWNQTLAVSLFSPSH
VLEAQLNDSKGEVLSVLYQMATTTEVLSSLGQKLLAFAGLSLVLLGTGLFMKRFLGPCGW
KYENIYITRQFVQFDERERHQQRPCVLPLNKEERRKYVIIPTFWPTPKERKNLGLFFLPI
LIHLCIWVLFAAVDYLLYRLIFSVSKQFQSLPGFEVHLKLHGEKQGTQDIIHDSSFNISV
FEPNCIPKPKFLLSETWVPLSVILLILVMLGLLSSILMQLKILVSASFYPSVERKRIQYL
HAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQMDMASADKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H295	1.000	1.000	2.954E-68	470	1.000	1.000	Q9H295.pdb.gz	DCSTP_HUMAN Dendritic cell-specific transmembrane protein OS=Homo sapiens OX=9606 GN=DCSTAMP PE=1 SV=1
2	AFDB:Q7TNJ0	0.916	0.916	6.124E-55	470	0.738	0.738	Q7TNJ0.pdb.gz	DCSTP_MOUSE Dendritic cell-specific transmembrane protein OS=Mus musculus OX=10090 GN=Dcstamp PE=1 SV=1
3	AFDB:D3ZVC2	0.563	0.737	9.479E-35	344	0.536	0.733	D3ZVC2.pdb.gz	D3ZVC2_RAT Dendrocyte expressed seven transmembrane protein OS=Rattus norvegicus OX=10116 GN=Dcstamp PE=4 SV=3
4	AFDB:Q9VU52	0.613	0.425	3.496E-15	715	0.196	0.129	Q9VU52.pdb.gz	SNKY_DROME Protein sneaky OS=Drosophila melanogaster OX=7227 GN=snky PE=2 SV=3
5	AFDB:Q9D611	0.623	0.593	8.516E-15	498	0.160	0.151	Q9D611.pdb.gz	OCSTP_MOUSE Osteoclast stimulatory transmembrane protein OS=Mus musculus OX=10090 GN=Ocstamp PE=1 SV=1
6	AFDB:Q5T197	0.641	0.441	2.120E-13	706	0.217	0.144	Q5T197.pdb.gz	DCST1_HUMAN E3 ubiquitin-protein ligase DCST1 OS=Homo sapiens OX=9606 GN=DCST1 PE=1 SV=1
7	AFDB:Q059Y8	0.634	0.424	2.584E-13	732	0.185	0.119	Q059Y8.pdb.gz	DCST1_MOUSE E3 ubiquitin-protein ligase DCST1 OS=Mus musculus OX=10090 GN=Dcst1 PE=1 SV=1
8	AFDB:F8W407	0.686	0.494	4.677E-13	675	0.191	0.133	F8W407.pdb.gz
9	AFDB:A0A140LIJ0	0.553	0.388	1.963E-12	701	0.215	0.144	A0A140LIJ0.pdb.gz	DCST2_MOUSE DC-STAMP domain-containing protein 2 OS=Mus musculus OX=10090 GN=Dcst2 PE=1 SV=1
10	AFDB:Q17461	0.528	0.336	5.217E-8	774	0.170	0.103	Q17461.pdb.gz	Q17461_CAEEL Dendritic cell-specific transmembrane protein-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=spe-42 PE=4 SV=5
11	PDB:6dmwA	0.119	0.094	2.304E-1	631	0.091	0.068	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.
12	PDB:7p54A	0.126	0.145	4.604E-1	397	0.132	0.156	7p54A.pdb.gz
13	PDB:7p5cA	0.122	0.136	5.896E-1	392	0.111	0.133	7p5cA.pdb.gz
14	PDB:6whgA	0.107	0.099	6.839E-1	523	0.060	0.054	6whgA.pdb.gz	Structure of the ancient TRPY1 channel from Saccharomyces cerevisiae reveals mechanisms of modulation by lipids and calcium.
15	PDB:6vq6H	0.100	0.176	7.186E-1	214	0.057	0.126	6vq6H.pdb.gz	Structure of V-ATPase from the mammalian brain.
16	PDB:5d80G	0.073	0.136	8.335E-1	223	0.079	0.166	5d80G.pdb.gz
17	PDB:7bylA	0.091	0.110	1.238	354	0.104	0.138	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
18	PDB:2jesA	0.073	0.087	1.585	370	0.038	0.049	2jesA.pdb.gz	Structural Framework for DNA Translocation Via the Viral Portal Protein
19	PDB:7lciR	0.076	0.087	1.750	393	0.134	0.160	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
20	PDB:2zdiC	0.097	0.287	1.839	148	0.040	0.128	2zdiC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZVC2	0.0	692	470	0.734	0.734	D3ZVC2_RAT Dendrocyte expressed seven transmembrane protein OS=Rattus norvegicus OX=10116 GN=Dcstamp PE=4 SV=3
2	Q7TNJ0	0.0	702	470	0.743	0.743	DCSTP_MOUSE Dendritic cell-specific transmembrane protein OS=Mus musculus OX=10090 GN=Dcstamp PE=1 SV=1
3	Q9H295	0.0	955	470	1.000	1.000	DCSTP_HUMAN Dendritic cell-specific transmembrane protein OS=Homo sapiens OX=9606 GN=DCSTAMP PE=1 SV=1
4	A0A140LIJ0	1.04e-10	66.2	701	0.138	0.093	DCST2_MOUSE DC-STAMP domain-containing protein 2 OS=Mus musculus OX=10090 GN=Dcst2 PE=1 SV=1
5	Q059Y8	2.84e-10	65.1	732	0.113	0.072	DCST1_MOUSE E3 ubiquitin-protein ligase DCST1 OS=Mus musculus OX=10090 GN=Dcst1 PE=1 SV=1
6	Q9VU52	4.39e-10	64.3	715	0.128	0.084	SNKY_DROME Protein sneaky OS=Drosophila melanogaster OX=7227 GN=snky PE=2 SV=3
7	Q5T197	1.33e-09	62.8	706	0.128	0.085	DCST1_HUMAN E3 ubiquitin-protein ligase DCST1 OS=Homo sapiens OX=9606 GN=DCST1 PE=1 SV=1
8	G0XYF0	0.020	39.7	456	0.094	0.096	G0XYF0_MOUSE Ceramide kinase-like isoform 2 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
9	Q54CB3	0.77	34.7	455	0.036	0.037	Q54CB3_DICDI Amino acid transporter transmembrane domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293074 PE=4 SV=1
10	P37758	9.7	31.2	462	0.038	0.039	NARU_ECOLI Nitrate/nitrite transporter NarU OS=Escherichia coli (strain K12) OX=83333 GN=narU PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07782 DC_STAMP	7e-51	184.2	DC-STAMP-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297581

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279028	0.950	Osteoclast stimulatory transmembrane protein
2	9606.ENSP00000342136	0.910	Cyclic AMP-responsive element-binding protein 3
3	9606.ENSP00000271651	0.886	Cathepsin K
4	9606.ENSP00000389377	0.870	Nuclear factor of activated T-cells, cytoplasmic 1
5	9606.ENSP00000318165	0.863	Protein OS-9
6	9606.ENSP00000285393	0.845	V-type proton ATPase subunit d 2
7	9606.ENSP00000381775	0.827	Tumor necrosis factor ligand superfamily member 11
8	9606.ENSP00000468767	0.815	Tartrate-resistant acid phosphatase type 5
9	9606.ENSP00000479089	0.726	Osteoclast-associated immunoglobulin-like receptor
10	9606.ENSP00000352561	0.687	Calcitonin receptor
11	9606.ENSP00000356954	0.675	Connective tissue growth factor
12	9606.ENSP00000306245	0.668	Proto-oncogene c-Fos
13	9606.ENSP00000465500	0.627	Tumor necrosis factor receptor superfamily member 11A
14	9606.ENSP00000327513	0.623	Macrophage colony-stimulating factor 1
15	9606.ENSP00000414904	0.587	Cathepsin O
16	9606.ENSP00000361405	0.554	Matrix metalloproteinase-9
17	9606.ENSP00000433623	0.545	TNF receptor-associated factor 6
18	9606.ENSP00000359663	0.537	CD40 ligand
19	9606.ENSP00000362205	0.524	Triggering receptor expressed on myeloid cells 2
20	9606.ENSP00000372193	0.513	H(+)/Cl(-) exchange transporter 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.995	response to stimulus
GO:0051716	0.985	cellular response to stimulus
GO:0070887	0.955	cellular response to chemical stimulus
GO:0071310	0.949	cellular response to organic substance
GO:0071345	0.943	cellular response to cytokine stimulus
GO:0050794	0.877	regulation of cellular process
GO:0048518	0.796	positive regulation of biological process
GO:0048522	0.785	positive regulation of cellular process
GO:0032502	0.605	developmental process
GO:0048856	0.599	anatomical structure development
GO:0030154	0.468	cell differentiation
GO:0002521	0.456	leukocyte differentiation
GO:0048519	0.449	negative regulation of biological process
GO:0032501	0.431	multicellular organismal process
GO:0002682	0.405	regulation of immune system process
GO:0051239	0.393	regulation of multicellular organismal process
GO:0002684	0.383	positive regulation of immune system process
GO:0019222	0.321	regulation of metabolic process
GO:0048523	0.306	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	0.999	cell surface
GO:0005789	0.998	endoplasmic reticulum membrane
GO:0071944	0.771	cell periphery
GO:0031982	0.729	vesicle
GO:0005886	0.724	plasma membrane
GO:0097708	0.687	intracellular vesicle
GO:0031410	0.646	cytoplasmic vesicle
GO:0098588	0.387	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]