StarFunc result for job id Q9H2A2

User Input

>input (487 residues)
MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPS
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
SLHHTSECTQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPS
ELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFVQKSIY
SEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGAQIWCGEGVDK
LSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLA
ATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEI
KTITVKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H2A2	1.000	1.000	0.000	487	1.000	1.000	Q9H2A2.pdb.gz	AL8A1_HUMAN 2-aminomuconic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH8A1 PE=1 SV=1
2	AFDB:Q8BH00	0.998	0.998	7.305E-99	487	0.899	0.899	Q8BH00.pdb.gz	AL8A1_MOUSE 2-aminomuconic semialdehyde dehydrogenase OS=Mus musculus OX=10090 GN=Aldh8a1 PE=1 SV=1
3	AFDB:Q66I21	0.993	0.993	1.584E-91	487	0.741	0.741	Q66I21.pdb.gz	AL8A1_DANRE 2-aminomuconic semialdehyde dehydrogenase OS=Danio rerio OX=7955 GN=aldh8a1 PE=2 SV=1
4	AFDB:Q56YU0	0.947	0.921	2.854E-61	501	0.372	0.361	Q56YU0.pdb.gz	AL2C4_ARATH Aldehyde dehydrogenase family 2 member C4 OS=Arabidopsis thaliana OX=3702 GN=ALDH2C4 PE=1 SV=2
5	AFDB:Q9DD46	0.945	0.900	9.590E-60	512	0.376	0.357	Q9DD46.pdb.gz	Q9DD46_CHICK Aldehyde dehydrogenase OS=Gallus gallus OX=9031 GN=ALDH6 PE=2 SV=1
6	AFDB:O35945	0.941	0.915	1.273E-59	501	0.384	0.373	O35945.pdb.gz	AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus OX=10090 GN=Aldh1a7 PE=1 SV=1
7	AFDB:Q9URW9	0.950	0.932	1.347E-59	496	0.345	0.339	Q9URW9.pdb.gz	YLX7_SCHPO Putative aldehyde dehydrogenase-like protein C922.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC922.07c PE=3 SV=1
8	AFDB:P40047	0.942	0.883	1.690E-59	520	0.368	0.344	P40047.pdb.gz	ALDH5_YEAST Aldehyde dehydrogenase 5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALD5 PE=1 SV=4
9	PDB:3iwjA	0.941	0.917	2.276E-59	500	0.359	0.350	3iwjA.pdb.gz	Structural and functional characterization of plant aminoaldehyde dehydrogenase from Pisum sativum with a broad specificity for natural and synthetic aminoaldehydes.
10	PDB:6aljA	0.939	0.929	2.409E-59	492	0.378	0.374	6aljA.pdb.gz	Structural Basis of ALDH1A2 Inhibition by Irreversible and Reversible Small Molecule Inhibitors.
11	AFDB:P00352	0.936	0.911	2.514E-59	501	0.386	0.375	P00352.pdb.gz	AL1A1_HUMAN Aldehyde dehydrogenase 1A1 OS=Homo sapiens OX=9606 GN=ALDH1A1 PE=1 SV=2
12	AFDB:P49189	0.951	0.938	2.660E-59	494	0.374	0.368	P49189.pdb.gz	AL9A1_HUMAN 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3
13	PDB:4fr8C	0.944	0.927	1.962E-58	496	0.374	0.367	4fr8C.pdb.gz	Vascular Bioactivation of Nitroglycerin by Aldehyde Dehydrogenase-2: REACTION INTERMEDIATES REVEALED BY CRYSTALLOGRAPHY AND MASS SPECTROMETRY.
14	PDB:5abmA	0.939	0.926	1.962E-58	494	0.390	0.385	5abmA.pdb.gz	Structural, Biochemical, and Computational Studies Reveal the Mechanism of Selective Aldehyde Dehydrogenase 1A1 Inhibition by Cytotoxic Duocarmycin Analogues.
15	PDB:7mjcA	0.941	0.929	3.458E-58	493	0.374	0.369	7mjcA.pdb.gz	Inhibitors targeted to aldehyde dehydrogenase
16	PDB:4v37A	0.946	0.930	3.660E-58	495	0.374	0.368	4v37A.pdb.gz	Identification of a Stable Thiohemiacetal Involving a Conserved Cysteine in the Substrate Inactivation of S. Oleracea Betaine Aldehyde Dehydrogenase
17	PDB:6vr6D	0.945	0.933	4.591E-58	493	0.374	0.369	6vr6D.pdb.gz	Inhibition, crystal structures, and in-solution oligomeric structure of aldehyde dehydrogenase 9A1.
18	PDB:7a6qA	0.942	0.939	5.442E-58	489	0.376	0.374	7a6qA.pdb.gz	A Selective Competitive Inhibitor of Aldehyde Dehydrogenase 1A3 Hinders Cancer Cell Growth, Invasiveness and Stemness In Vitro.
19	PDB:4i9bA	0.940	0.923	1.203E-57	496	0.370	0.363	4i9bA.pdb.gz	Plant ALDH10 family: identifying critical residues for substrate specificity and trapping a thiohemiacetal intermediate.
20	PDB:7rluA	0.939	0.787	4.432E-57	583	0.361	0.302	7rluA.pdb.gz	Structure of putative tumor suppressor ALDH1L1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q66I21	0.0	795	487	0.741	0.741	AL8A1_DANRE 2-aminomuconic semialdehyde dehydrogenase OS=Danio rerio OX=7955 GN=aldh8a1 PE=2 SV=1
2	Q8BH00	0.0	898	487	0.899	0.899	AL8A1_MOUSE 2-aminomuconic semialdehyde dehydrogenase OS=Mus musculus OX=10090 GN=Aldh8a1 PE=1 SV=1
3	Q9H2A2	0.0	1010	487	1.000	1.000	AL8A1_HUMAN 2-aminomuconic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH8A1 PE=1 SV=1
4	Q56YU0	5.36e-119	360	501	0.370	0.359	AL2C4_ARATH Aldehyde dehydrogenase family 2 member C4 OS=Arabidopsis thaliana OX=3702 GN=ALDH2C4 PE=1 SV=2
5	P51977	7.02e-118	357	501	0.394	0.383	AL1A1_SHEEP Aldehyde dehydrogenase 1A1 OS=Ovis aries OX=9940 GN=ALDH1A1 PE=1 SV=2
6	P48644	7.57e-118	357	501	0.394	0.383	AL1A1_BOVIN Aldehyde dehydrogenase 1A1 OS=Bos taurus OX=9913 GN=ALDH1A1 PE=1 SV=3
7	P49189	1.94e-116	353	494	0.368	0.362	AL9A1_HUMAN 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3
8	O35945	1.83e-115	351	501	0.378	0.367	AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus OX=10090 GN=Aldh1a7 PE=1 SV=1
9	Q7SXU3	4.39e-115	350	516	0.390	0.368	Q7SXU3_DANRE Aldehyde dehydrogenase 2 OS=Danio rerio OX=7955 GN=aldh2a PE=1 SV=1
10	Q6TH48	6.68e-115	350	516	0.382	0.360	Q6TH48_DANRE Aldehyde dehydrogenase 2 family member, tandem duplicate 2 OS=Danio rerio OX=7955 GN=ALDH2 PE=1 SV=1
11	Q9JLJ2	1.41e-114	348	494	0.372	0.366	AL9A1_MOUSE 4-trimethylaminobutyraldehyde dehydrogenase OS=Mus musculus OX=10090 GN=Aldh9a1 PE=1 SV=1
12	P13601	1.99e-114	348	501	0.392	0.381	AL1A7_RAT Aldehyde dehydrogenase, cytosolic 1 OS=Rattus norvegicus OX=10116 GN=Aldh1a7 PE=1 SV=2
13	A0A286XPF7	1.12e-113	347	521	0.380	0.355	A0A286XPF7_CAVPO Aldehyde dehydrogenase 2 family member OS=Cavia porcellus OX=10141 GN=ALDH2 PE=3 SV=1
14	Q8MI17	1.53e-113	346	496	0.384	0.377	AL1A1_RABIT Aldehyde dehydrogenase 1A1 OS=Oryctolagus cuniculus OX=9986 GN=ALDH1A1 PE=1 SV=1
15	P24549	2.51e-113	345	501	0.382	0.371	AL1A1_MOUSE Aldehyde dehydrogenase 1A1 OS=Mus musculus OX=10090 GN=Aldh1a1 PE=1 SV=5
16	P00352	4.13e-113	345	501	0.382	0.371	AL1A1_HUMAN Aldehyde dehydrogenase 1A1 OS=Homo sapiens OX=9606 GN=ALDH1A1 PE=1 SV=2
17	V9HW83	4.13e-113	345	501	0.382	0.371	V9HW83_HUMAN Epididymis luminal protein 12 OS=Homo sapiens OX=9606 GN=HEL-S-53e PE=2 SV=1
18	O94788	2.16e-112	343	518	0.376	0.353	AL1A2_HUMAN Retinal dehydrogenase 2 OS=Homo sapiens OX=9606 GN=ALDH1A2 PE=1 SV=3
19	Q28399	3.21e-112	342	501	0.390	0.379	ALDH1_ELEED Aldehyde dehydrogenase, cytosolic 1 OS=Elephantulus edwardii OX=28737 GN=ALDH1 PE=1 SV=1
20	Q8HYE4	5.51e-112	342	501	0.380	0.369	AL1A1_MACFA Aldehyde dehydrogenase 1A1 OS=Macaca fascicularis OX=9541 GN=ALDH1A1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00171 Aldedh	3.1e-165	561.8	Aldehyde dehydrogenase family
2	PF07368 DUF1487	1.9e+02	12.9	Protein of unknown function (DUF1487)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265605

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348459	0.920	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
2	9606.ENSP00000302620	0.804	Alanine-glyoxylate aminotransferase
3	9606.ENSP00000360268	0.773	Delta-1-pyrroline-5-carboxylate synthase
4	9606.ENSP00000310661	0.766	cAMP-specific 3',5'-cyclic phosphodiesterase 7B
5	9606.ENSP00000356811	0.762	HBS1-like protein
6	9606.ENSP00000379865	0.749	Hydroxyacid-oxoacid transhydrogenase, mitochondrial
7	9606.ENSP00000181383	0.715	Carboxypeptidase B2
8	9606.ENSP00000356774	0.697	Jouberin
9	9606.ENSP00000450436	0.692	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
10	9606.ENSP00000237264	0.690	TATA box-binding protein-like protein 1
11	9606.ENSP00000283871	0.675	Homogentisate 1,2-dioxygenase
12	9606.ENSP00000309031	0.674	Deubiquitinating protein VCIP135
13	9606.ENSP00000230050	0.669	Ribosomal protein S12
14	9606.ENSP00000447149	0.662	Bile acid receptor
15	9606.ENSP00000355517	0.661	Kynurenine 3-monooxygenase
16	9606.ENSP00000232003	0.655	Histidine-rich glycoprotein
17	9606.ENSP00000448059	0.655	Catalyzes the hydroxylation of L-phenylalanine to L-tyrosine.
18	9606.ENSP00000323568	0.654	Solute carrier family 2, facilitated glucose transporter member 2
19	9606.ENSP00000356857	0.654	Transcription factor 21
20	9606.ENSP00000356671	0.651	Antithrombin-III

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016620	1.000	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0005488	0.977	binding
GO:0004030	0.977	aldehyde dehydrogenase [NAD(P)+] activity
GO:0005515	0.905	protein binding
GO:0004029	0.897	aldehyde dehydrogenase (NAD+) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044281	0.986	small molecule metabolic process
GO:0006721	0.986	terpenoid metabolic process
GO:0006081	0.985	cellular aldehyde metabolic process
GO:0001523	0.984	retinoid metabolic process
GO:0042445	0.979	hormone metabolic process
GO:0032787	0.977	monocarboxylic acid metabolic process
GO:0120254	0.975	olefinic compound metabolic process
GO:0042573	0.943	retinoic acid metabolic process
GO:0042574	0.849	retinal metabolic process
GO:0006807	0.353	nitrogen compound metabolic process
GO:0050789	0.319	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.999	membrane-bounded organelle
GO:0005576	0.982	extracellular region
GO:0005615	0.966	extracellular space
GO:0070062	0.961	extracellular exosome
GO:0043229	0.729	intracellular organelle
GO:0043231	0.723	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.1.-	1.000	With NAD(+) or NADP(+) as acceptor.
EC:1.2.1.5	0.977	aldehyde dehydrogenase [NAD(P)(+)].
RHEA:16185	0.897	an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH
EC:1.2.1.3	0.897	aldehyde dehydrogenase (NAD(+)).

[back to server]