StarFunc result for job id Q9H2B2

User Input

>input (425 residues)
MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGV
DIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLEN
ATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGL
PAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYTQIQELALHF
TILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKRNVRKSSGRGELLISLCYQST
TNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVF
DIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWH
VLCDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H2B2	1.000	1.000	1.779E-75	425	1.000	1.000	Q9H2B2.pdb.gz	SYT4_HUMAN Synaptotagmin-4 OS=Homo sapiens OX=9606 GN=SYT4 PE=1 SV=1
2	AFDB:P40749	0.640	0.640	1.136E-68	425	0.899	0.899	P40749.pdb.gz	SYT4_MOUSE Synaptotagmin-4 OS=Mus musculus OX=10090 GN=Syt4 PE=1 SV=2
3	AFDB:Q8SYD5	0.421	0.386	3.118E-40	474	0.400	0.359	Q8SYD5.pdb.gz	Q8SYD5_DROME RE67111p OS=Drosophila melanogaster OX=7227 GN=Syt4 PE=2 SV=1
4	AFDB:Q9V4C4	0.553	0.564	6.207E-38	416	0.322	0.329	Q9V4C4.pdb.gz	Q9V4C4_DROME Synaptotagmin 7, isoform A OS=Drosophila melanogaster OX=7227 GN=Syt7 PE=1 SV=4
5	AFDB:Q86SS6	0.431	0.385	1.373E-37	491	0.322	0.279	Q86SS6.pdb.gz	SYT9_HUMAN Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE=1 SV=1
6	AFDB:Q95QH7	0.482	0.466	3.857E-34	443	0.311	0.298	Q95QH7.pdb.gz	Q95QH7_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=1 SV=1
7	AFDB:K8FE10	0.335	0.382	1.488E-32	369	0.268	0.309	K8FE10.pdb.gz	SYT2_CAEEL Synaptotagmin 2 OS=Caenorhabditis elegans OX=6239 GN=snt-2 PE=1 SV=1
8	AFDB:Q9Y2J0	0.326	0.206	3.962E-31	694	0.252	0.154	Q9Y2J0.pdb.gz	RP3A_HUMAN Rabphilin-3A OS=Homo sapiens OX=9606 GN=RPH3A PE=1 SV=1
9	AFDB:C0HDP4	0.497	0.429	7.093E-31	504	0.261	0.220	C0HDP4.pdb.gz	C0HDP4_DROME MIP05618p OS=Drosophila melanogaster OX=7227 GN=Sytalpha PE=2 SV=1
10	AFDB:F1R9U1	0.318	0.320	6.909E-30	422	0.242	0.244	F1R9U1.pdb.gz	F1R9U1_DANRE Double C2-like domain-containing protein alpha OS=Danio rerio OX=7955 GN=si:dkey-93n13.3 PE=4 SV=2
11	PDB:3pfqA	0.277	0.228	7.245E-11	523	0.096	0.078	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:5iz5B	0.209	0.122	2.035E-7	746	0.099	0.056	5iz5B.pdb.gz
13	PDB:6kxkD	0.188	0.147	5.866E-7	553	0.106	0.081	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
14	PDB:5iz5A	0.192	0.110	1.831E-5	757	0.092	0.052	5iz5A.pdb.gz
15	PDB:5a50A	0.196	0.482	2.515E-5	165	0.087	0.224	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	PDB:5izrC	0.200	0.131	3.842E-5	659	0.096	0.062	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5ixcA	0.208	0.132	4.271E-5	684	0.096	0.060	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
18	PDB:5a52A	0.188	0.482	7.645E-5	154	0.068	0.188	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:4rj9A	0.176	0.444	3.549E-4	161	0.068	0.180	4rj9A.pdb.gz
20	PDB:3nsjA	0.174	0.141	6.699E-4	530	0.045	0.036	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P40749	0.0	773	425	0.899	0.899	SYT4_MOUSE Synaptotagmin-4 OS=Mus musculus OX=10090 GN=Syt4 PE=1 SV=2
2	P50232	0.0	774	425	0.899	0.899	SYT4_RAT Synaptotagmin-4 OS=Rattus norvegicus OX=10116 GN=Syt4 PE=1 SV=1
3	Q9H2B2	0.0	873	425	1.000	1.000	SYT4_HUMAN Synaptotagmin-4 OS=Homo sapiens OX=9606 GN=SYT4 PE=1 SV=1
4	Q9R0N3	5.89e-155	447	430	0.534	0.528	SYT11_MOUSE Synaptotagmin-11 OS=Mus musculus OX=10090 GN=Syt11 PE=1 SV=2
5	O08835	1.97e-153	443	430	0.529	0.523	SYT11_RAT Synaptotagmin-11 OS=Rattus norvegicus OX=10116 GN=Syt11 PE=1 SV=2
6	Q9BT88	4.62e-153	442	431	0.529	0.522	SYT11_HUMAN Synaptotagmin-11 OS=Homo sapiens OX=9606 GN=SYT11 PE=1 SV=2
7	Q8SYD5	1.98e-96	299	474	0.362	0.325	Q8SYD5_DROME RE67111p OS=Drosophila melanogaster OX=7227 GN=Syt4 PE=2 SV=1
8	Q9U6P7	3.82e-96	298	474	0.362	0.325	Q9U6P7_DROME FI18813p1 OS=Drosophila melanogaster OX=7227 GN=Syt4 PE=2 SV=1
9	D4P8S0	2.06e-73	239	488	0.301	0.262	D4P8S0_DANRE Synaptotagmin VIIb OS=Danio rerio OX=7955 GN=syt7 PE=2 SV=1
10	O43581	6.62e-73	236	403	0.280	0.295	SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE=1 SV=3
11	Q59DP7	2.53e-72	230	283	0.271	0.406	Q59DP7_DROME Synaptotagmin 7, isoform F OS=Drosophila melanogaster OX=7227 GN=Syt7 PE=4 SV=1
12	Q9V4C4	4.62e-71	231	416	0.275	0.281	Q9V4C4_DROME Synaptotagmin 7, isoform A OS=Drosophila melanogaster OX=7227 GN=Syt7 PE=1 SV=4
13	Q9R0N7	1.23e-68	224	403	0.280	0.295	SYT7_MOUSE Synaptotagmin-7 OS=Mus musculus OX=10090 GN=Syt7 PE=1 SV=1
14	Q62747	1.47e-68	224	403	0.280	0.295	SYT7_RAT Synaptotagmin-7 OS=Rattus norvegicus OX=10116 GN=Syt7 PE=1 SV=1
15	P21521	4.97e-66	220	474	0.311	0.278	SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3
16	Q86SS6	7.30e-65	217	491	0.268	0.232	SYT9_HUMAN Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE=1 SV=1
17	Q62746	9.43e-65	218	511	0.296	0.247	SYT6_RAT Synaptotagmin-6 OS=Rattus norvegicus OX=10116 GN=Syt6 PE=1 SV=1
18	Q5T7P8	1.21e-64	217	510	0.299	0.249	SYT6_HUMAN Synaptotagmin-6 OS=Homo sapiens OX=9606 GN=SYT6 PE=1 SV=3
19	Q9R0N8	7.84e-64	215	511	0.294	0.245	SYT6_MOUSE Synaptotagmin-6 OS=Mus musculus OX=10090 GN=Syt6 PE=1 SV=2
20	P46097	1.16e-63	212	422	0.285	0.287	SYT2_MOUSE Synaptotagmin-2 OS=Mus musculus OX=10090 GN=Syt2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	9.7e-41	149.6	C2 domain
2	PF10409 PTEN_C2	26	16.0	C2 domain of PTEN tumour-suppressor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255224

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254976	0.888	Synaptosomal-associated protein 25
2	9606.ENSP00000262545	0.871	Neuroendocrine convertase 2
3	9606.ENSP00000305613	0.863	Complexin-1
4	9606.ENSP00000222812	0.795	Syntaxin-1A
5	9606.ENSP00000295987	0.795	Synapsin-1
6	9606.ENSP00000480050	0.795	Synapsin-2
7	9606.ENSP00000215095	0.775	Syntaxin-1B
8	9606.ENSP00000261205	0.755	Synaptotagmin-1
9	9606.ENSP00000249647	0.749	Synaptosomal-associated protein 23
10	9606.ENSP00000314214	0.739	Vesicle-associated membrane protein 2
11	9606.ENSP00000385142	0.738	Neurexin-1
12	9606.ENSP00000351614	0.736	Synapsin-3
13	9606.ENSP00000368244	0.731	Secretogranin-1
14	9606.ENSP00000222256	0.729	Ras-related protein Rab-3A
15	9606.ENSP00000352544	0.721	Complexin-2
16	9606.ENSP00000321805	0.714	GTP-binding protein Rit2
17	9606.ENSP00000263233	0.706	Synaptophysin
18	9606.ENSP00000367756	0.706	Protein unc-13 homolog B
19	9606.ENSP00000429562	0.706	Protein unc-13 homolog A
20	9606.ENSP00000216492	0.698	Chromogranin-A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.736	lipid binding
GO:0005543	0.731	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0051179	0.957	localization
GO:0051046	0.957	regulation of secretion
GO:1903530	0.945	regulation of secretion by cell
GO:0006810	0.940	transport
GO:0065008	0.926	regulation of biological quality
GO:0051128	0.875	regulation of cellular component organization
GO:0048518	0.863	positive regulation of biological process
GO:0048522	0.844	positive regulation of cellular process
GO:0050433	0.841	regulation of catecholamine secretion
GO:0060627	0.792	regulation of vesicle-mediated transport
GO:0051649	0.791	establishment of localization in cell
GO:1903531	0.753	negative regulation of secretion by cell
GO:0010646	0.721	regulation of cell communication
GO:0023051	0.720	regulation of signaling
GO:0001505	0.704	regulation of neurotransmitter levels
GO:0050793	0.651	regulation of developmental process
GO:0032501	0.614	multicellular organismal process
GO:0017157	0.600	regulation of exocytosis
GO:0046907	0.516	intracellular transport
GO:1903305	0.514	regulation of regulated secretory pathway
GO:0051953	0.513	negative regulation of amine transport
GO:0051588	0.484	regulation of neurotransmitter transport
GO:0022603	0.474	regulation of anatomical structure morphogenesis
GO:0051239	0.471	regulation of multicellular organismal process
GO:0046928	0.464	regulation of neurotransmitter secretion
GO:0051650	0.452	establishment of vesicle localization
GO:0007154	0.450	cell communication
GO:0023052	0.447	signaling
GO:0033043	0.446	regulation of organelle organization
GO:0040008	0.440	regulation of growth
GO:0017158	0.416	regulation of calcium ion-dependent exocytosis
GO:0031338	0.414	regulation of vesicle fusion
GO:0045920	0.382	negative regulation of exocytosis
GO:0051094	0.374	positive regulation of developmental process
GO:0050896	0.370	response to stimulus
GO:0014059	0.348	regulation of dopamine secretion
GO:0007267	0.346	cell-cell signaling
GO:0071840	0.313	cellular component organization or biogenesis
GO:0007268	0.300	chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0030054	0.997	cell junction
GO:0099503	0.997	secretory vesicle
GO:0045202	0.990	synapse
GO:0031090	0.985	organelle membrane
GO:0120025	0.980	plasma membrane bounded cell projection
GO:0030659	0.974	cytoplasmic vesicle membrane
GO:0005886	0.965	plasma membrane
GO:0098588	0.965	bounding membrane of organelle
GO:0030141	0.925	secretory granule
GO:0043005	0.924	neuron projection
GO:0098992	0.891	neuronal dense core vesicle
GO:0097386	0.889	glial cell projection
GO:0098793	0.864	presynapse
GO:0005794	0.847	Golgi apparatus
GO:0097449	0.844	astrocyte projection
GO:0030667	0.838	secretory granule membrane
GO:0044297	0.780	cell body
GO:0036477	0.758	somatodendritic compartment
GO:0005576	0.614	extracellular region
GO:0008021	0.531	synaptic vesicle
GO:0030424	0.479	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]