StarFunc result for job id Q9H2C1

User Input

>input (402 residues)
MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRF
GTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYL
SSSSLKEGSLNSVSSCTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGP
PSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDTPSPEPGLPGT
LHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61375	0.628	0.628	2.780E-64	402	0.988	0.988	P61375.pdb.gz	LHX5_MOUSE LIM/homeobox protein Lhx5 OS=Mus musculus OX=10090 GN=Lhx5 PE=2 SV=1
2	AFDB:P37137	0.540	0.540	2.177E-57	402	0.838	0.838	P37137.pdb.gz	LHX5_XENLA LIM/homeobox protein Lhx5 OS=Xenopus laevis OX=8355 GN=lhx5 PE=1 SV=2
3	AFDB:P52889	0.608	0.612	1.841E-54	399	0.781	0.787	P52889.pdb.gz	LHX5_DANRE LIM/homeobox protein Lhx5 OS=Danio rerio OX=7955 GN=lhx5 PE=2 SV=1
4	AFDB:P48742	0.554	0.550	4.704E-52	406	0.759	0.751	P48742.pdb.gz	LHX1_HUMAN LIM/homeobox protein Lhx1 OS=Homo sapiens OX=9606 GN=LHX1 PE=1 SV=2
5	AFDB:Q9V472	0.366	0.300	2.563E-31	505	0.470	0.374	Q9V472.pdb.gz	Q9V472_DROME DLim1 OS=Drosophila melanogaster OX=7227 GN=Lim1 PE=1 SV=1
6	AFDB:P20154	0.330	0.328	6.147E-29	405	0.378	0.375	P20154.pdb.gz	LIN11_CAEEL Protein lin-11 OS=Caenorhabditis elegans OX=6239 GN=lin-11 PE=1 SV=2
7	AFDB:Q90421	0.313	0.316	1.684E-28	398	0.348	0.352	Q90421.pdb.gz	LHX3_DANRE LIM/homeobox protein Lhx3 OS=Danio rerio OX=7955 GN=lhx3 PE=2 SV=1
8	AFDB:B0S5S7	0.312	0.320	2.035E-28	391	0.338	0.348	B0S5S7.pdb.gz	B0S5S7_DANRE LIM homeobox 4 OS=Danio rerio OX=7955 GN=si:dkeyp-35f11.3 PE=4 SV=1
9	AFDB:P53776	0.308	0.317	3.162E-28	390	0.346	0.356	P53776.pdb.gz	LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus OX=10090 GN=Lhx4 PE=1 SV=4
10	AFDB:P36200	0.309	0.314	5.936E-28	395	0.336	0.342	P36200.pdb.gz	LHX3_XENLA LIM/homeobox protein Lhx3 OS=Xenopus laevis OX=8355 GN=lhx3 PE=1 SV=1
11	PDB:4kfzB	0.167	0.423	6.186E-12	148	0.097	0.264	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.143	0.290	6.873E-6	192	0.070	0.146	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.143	0.645	1.548E-3	76	0.052	0.276	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:4egcA	0.124	0.092	1.091E-2	539	0.040	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
15	PDB:5dkaA	0.068	0.229	3.955E-1	96	0.035	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
16	PDB:7uhyD	0.103	0.136	8.971E-1	288	0.027	0.038	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:7uhyC	0.111	0.080	1.154	578	0.035	0.024	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
18	PDB:7uhyA	0.049	0.032	1.309	771	0.052	0.027	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:4r8pL	0.085	0.117	1.394	254	0.030	0.047	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
20	PDB:7r7jB	0.069	0.055	1.394	574	0.050	0.035	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29674	0.0	612	403	0.751	0.749	LHX1_XENLA LIM/homeobox protein Lhx1 OS=Xenopus laevis OX=8355 GN=lhx1 PE=1 SV=1
2	P37137	0.0	692	402	0.853	0.853	LHX5_XENLA LIM/homeobox protein Lhx5 OS=Xenopus laevis OX=8355 GN=lhx5 PE=1 SV=2
3	P48742	0.0	618	406	0.759	0.751	LHX1_HUMAN LIM/homeobox protein Lhx1 OS=Homo sapiens OX=9606 GN=LHX1 PE=1 SV=2
4	P52889	0.0	631	399	0.791	0.797	LHX5_DANRE LIM/homeobox protein Lhx5 OS=Danio rerio OX=7955 GN=lhx5 PE=2 SV=1
5	P53411	0.0	613	406	0.759	0.751	LHX1_CHICK LIM/homeobox protein Lhx1 OS=Gallus gallus OX=9031 GN=LHX1 PE=2 SV=1
6	P61375	0.0	828	402	0.988	0.988	LHX5_MOUSE LIM/homeobox protein Lhx5 OS=Mus musculus OX=10090 GN=Lhx5 PE=2 SV=1
7	P63006	0.0	616	406	0.756	0.749	LHX1_MOUSE LIM/homeobox protein Lhx1 OS=Mus musculus OX=10090 GN=Lhx1 PE=1 SV=1
8	P63007	0.0	616	406	0.756	0.749	LHX1_RAT LIM/homeobox protein Lhx1 OS=Rattus norvegicus OX=10116 GN=Lhx1 PE=1 SV=1
9	Q9H2C1	0.0	838	402	1.000	1.000	LHX5_HUMAN LIM/homeobox protein Lhx5 OS=Homo sapiens OX=9606 GN=LHX5 PE=1 SV=1
10	Q9V472	6.34e-106	323	505	0.408	0.325	Q9V472_DROME DLim1 OS=Drosophila melanogaster OX=7227 GN=Lim1 PE=1 SV=1
11	P20154	9.83e-85	266	405	0.331	0.328	LIN11_CAEEL Protein lin-11 OS=Caenorhabditis elegans OX=6239 GN=lin-11 PE=1 SV=2
12	B0S5S7	9.19e-80	252	391	0.301	0.309	B0S5S7_DANRE LIM homeobox 4 OS=Danio rerio OX=7955 GN=si:dkeyp-35f11.3 PE=4 SV=1
13	P53776	1.56e-79	252	390	0.306	0.315	LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus OX=10090 GN=Lhx4 PE=1 SV=4
14	Q969G2	5.05e-79	250	390	0.296	0.305	LHX4_HUMAN LIM/homeobox protein Lhx4 OS=Homo sapiens OX=9606 GN=LHX4 PE=1 SV=2
15	Q90421	1.50e-77	247	398	0.376	0.379	LHX3_DANRE LIM/homeobox protein Lhx3 OS=Danio rerio OX=7955 GN=lhx3 PE=2 SV=1
16	P36200	1.75e-76	244	395	0.301	0.306	LHX3_XENLA LIM/homeobox protein Lhx3 OS=Xenopus laevis OX=8355 GN=lhx3 PE=1 SV=1
17	O97581	3.03e-76	243	383	0.299	0.313	LHX3_PIG LIM/homeobox protein Lhx3 (Fragment) OS=Sus scrofa OX=9823 GN=LHX3 PE=2 SV=1
18	Q9UBR4	2.87e-75	241	397	0.296	0.300	LHX3_HUMAN LIM/homeobox protein Lhx3 OS=Homo sapiens OX=9606 GN=LHX3 PE=1 SV=2
19	G3V9E7	8.04e-75	240	402	0.294	0.294	G3V9E7_RAT LIM homeobox 3 OS=Rattus norvegicus OX=10116 GN=Lhx3 PE=4 SV=1
20	G3V8E3	1.21e-74	239	400	0.294	0.295	G3V8E3_RAT LIM homeobox 3 OS=Rattus norvegicus OX=10116 GN=Lhx3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	0.023	25.9	Homeobox KN domain
2	PF00046 Homeodomain	2e-16	70.9	Homeodomain
3	PF00412 LIM	1e-30	117.1	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261731

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359212	0.789	Transcription factor LBX1
2	9606.ENSP00000328596	0.644	Homeobox protein SIX6
3	9606.ENSP00000430241	0.613	Transcription factor COE2
4	9606.ENSP00000266066	0.610	Secreted frizzled-related protein 5
5	9606.ENSP00000392466	0.608	LIM domain-binding protein 1
6	9606.ENSP00000436881	0.605	Homeobox protein DBX1
7	9606.ENSP00000419153	0.601	Zinc finger and BTB domain-containing protein 20
8	9606.ENSP00000260653	0.588	Homeobox protein SIX3
9	9606.ENSP00000374205	0.564	T-box brain protein 1
10	9606.ENSP00000346879	0.558	Homeobox protein Nkx-2.1
11	9606.ENSP00000359319	0.553	Paired box protein Pax-2
12	9606.ENSP00000306772	0.536	LIM domain-binding protein 2
13	9606.ENSP00000483333	0.536	SKI family transcriptional corepressor 2
14	9606.ENSP00000450962	0.530	Homeobox protein EMX2
15	9606.ENSP00000263610	0.523	BarH-like 1 homeobox protein
16	9606.ENSP00000359474	0.514	BarH-like 2 homeobox protein
17	9606.ENSP00000366413	0.512	POU domain, class 4, transcription factor 1
18	9606.ENSP00000230732	0.507	POU domain, class 4, transcription factor 3
19	9606.ENSP00000258106	0.506	Homeobox protein EMX1
20	9606.ENSP00000379975	0.504	Integrin-linked protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043565	0.997	sequence-specific DNA binding
GO:0003690	0.997	double-stranded DNA binding
GO:1990837	0.993	sequence-specific double-stranded DNA binding
GO:0140110	0.934	transcription regulator activity
GO:0003700	0.824	DNA-binding transcription factor activity
GO:0000976	0.800	transcription cis-regulatory region binding
GO:0000977	0.790	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.560	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.473	transcription factor binding
GO:0001228	0.376	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007275	0.996	multicellular organism development
GO:0065007	0.988	biological regulation
GO:0048731	0.981	system development
GO:0050789	0.978	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0048513	0.960	animal organ development
GO:0009987	0.956	cellular process
GO:0019222	0.935	regulation of metabolic process
GO:0007399	0.929	nervous system development
GO:0060255	0.909	regulation of macromolecule metabolic process
GO:0009653	0.904	anatomical structure morphogenesis
GO:0048869	0.897	cellular developmental process
GO:0010468	0.886	regulation of gene expression
GO:0030154	0.883	cell differentiation
GO:0031323	0.802	regulation of cellular metabolic process
GO:0051171	0.786	regulation of nitrogen compound metabolic process
GO:0080090	0.784	regulation of primary metabolic process
GO:0019219	0.760	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.749	regulation of RNA metabolic process
GO:0010556	0.748	regulation of macromolecule biosynthetic process
GO:0031326	0.745	regulation of cellular biosynthetic process
GO:1903506	0.740	regulation of nucleic acid-templated transcription
GO:0006355	0.734	regulation of DNA-templated transcription
GO:0007417	0.707	central nervous system development
GO:0048518	0.696	positive regulation of biological process
GO:0048522	0.669	positive regulation of cellular process
GO:0060322	0.552	head development
GO:0050896	0.533	response to stimulus
GO:0048519	0.504	negative regulation of biological process
GO:0009893	0.491	positive regulation of metabolic process
GO:0007420	0.478	brain development
GO:0010604	0.473	positive regulation of macromolecule metabolic process
GO:0031325	0.468	positive regulation of cellular metabolic process
GO:0051173	0.454	positive regulation of nitrogen compound metabolic process
GO:0051254	0.442	positive regulation of RNA metabolic process
GO:0010557	0.439	positive regulation of macromolecule biosynthetic process
GO:0048523	0.438	negative regulation of cellular process
GO:0030182	0.424	neuron differentiation
GO:0045893	0.420	positive regulation of DNA-templated transcription
GO:0006357	0.414	regulation of transcription by RNA polymerase II
GO:0045944	0.375	positive regulation of transcription by RNA polymerase II
GO:0009892	0.373	negative regulation of metabolic process
GO:0031324	0.301	negative regulation of cellular metabolic process
GO:0010605	0.300	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.936	protein-containing complex
GO:0031981	0.666	nuclear lumen
GO:0005654	0.650	nucleoplasm
GO:0005667	0.546	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]