StarFunc result for job id Q9H2D1

User Input

>input (315 residues)
MTGQGQSASGSSAWSTVFRHVRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRP
KYNGILHCLTTIWKLDGLRGLYQGVTPNIWGAGLSWGLYFFFYNAIKSYKTEGRAERLEA
TEYLVSAAEAGAMTLCITNPLWVTKTRLMLQYDAVVNSPHRQYKGMFDTLVKIYKYEGVR
GLYKGFVPGLFGTSHGALQFMAYELLKLKYNQHINRLPEAQLSTVEYISVAALSKIFAVA
ATYPYQVVRARLQDQHMFYSGVIDVITKTWRKEGVGGFYKGIAPNLIRVTPACCITFVVY
ENVSHFLLDLREKRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IZB5	0.953	0.950	3.115E-38	316	0.902	0.899	Q6IZB5.pdb.gz	S2532_CRIGR Solute carrier family 25 member 32 OS=Cricetulus griseus OX=10029 GN=SLC25A32 PE=1 SV=1
2	AFDB:Q7XA87	0.852	0.871	1.181E-21	308	0.410	0.419	Q7XA87.pdb.gz	FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FOLT1 PE=2 SV=1
3	AFDB:Q8RWA5	0.819	0.716	1.573E-19	363	0.362	0.314	Q8RWA5.pdb.gz	NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDT2 PE=1 SV=1
4	AFDB:O22261	0.821	0.828	2.136E-19	312	0.365	0.369	O22261.pdb.gz	NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NDT1 PE=1 SV=2
5	AFDB:P40464	0.784	0.793	9.853E-19	311	0.298	0.302	P40464.pdb.gz	FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLX1 PE=3 SV=1
6	AFDB:O13660	0.750	0.844	4.747E-18	277	0.330	0.375	O13660.pdb.gz	YBC9_SCHPO Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi069 PE=3 SV=1
7	AFDB:O04200	0.816	0.778	4.959E-18	331	0.276	0.263	O04200.pdb.gz	PXN_ARATH Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana OX=3702 GN=PXN PE=1 SV=1
8	AFDB:P40556	0.827	0.706	8.018E-18	373	0.327	0.276	P40556.pdb.gz	YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIA6 PE=1 SV=1
9	AFDB:P39953	0.815	0.769	2.190E-17	335	0.321	0.301	P39953.pdb.gz	YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEA6 PE=1 SV=1
10	AFDB:Q9UTD6	0.721	0.619	9.667E-17	371	0.333	0.283	Q9UTD6.pdb.gz	YID3_SCHPO Uncharacterized mitochondrial carrier C227.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC227.03c PE=3 SV=1
11	PDB:4c9qB	0.739	0.798	2.083E-12	290	0.248	0.269	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.712	0.759	6.859E-11	293	0.229	0.246	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.511	0.542	8.115E-8	292	0.222	0.240	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:1is2A	0.187	0.117	2.284E-1	637	0.124	0.061	1is2A.pdb.gz	Three-dimensional structure of the flavoenzyme acyl-CoA oxidase-II from rat liver, the peroxisomal counterpart of mitochondrial acyl-CoA dehydrogenase.
15	PDB:5nbdA	0.190	0.128	2.386E-1	564	0.124	0.069	5nbdA.pdb.gz	Structural basis of inhibition of lipid-linked oligosaccharide flippase PglK by a conformational nanobody.
16	PDB:7ezmD	0.154	0.157	3.101E-1	304	0.102	0.105	7ezmD.pdb.gz	Ligand recognition and G-protein coupling selectivity of cholecystokinin A receptor
17	PDB:7p5cA	0.153	0.133	3.858E-1	392	0.143	0.115	7p5cA.pdb.gz
18	PDB:7lciR	0.184	0.158	4.210E-1	393	0.130	0.104	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
19	PDB:7p5jA	0.117	0.104	4.398E-1	399	0.137	0.108	7p5jA.pdb.gz
20	PDB:6wpwR	0.184	0.160	4.595E-1	398	0.152	0.121	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IZB5	0.0	595	316	0.902	0.899	S2532_CRIGR Solute carrier family 25 member 32 OS=Cricetulus griseus OX=10029 GN=SLC25A32 PE=1 SV=1
2	Q8BMG8	0.0	579	316	0.905	0.902	S2532_MOUSE Solute carrier family 25 member 32 OS=Mus musculus OX=10090 GN=Slc25a32 PE=1 SV=1
3	Q9H2D1	0.0	652	315	1.000	1.000	S2532_HUMAN Solute carrier family 25 member 32 OS=Homo sapiens OX=9606 GN=SLC25A32 PE=1 SV=2
4	Q7XA87	4.04e-73	229	308	0.416	0.425	FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FOLT1 PE=2 SV=1
5	O13660	6.58e-56	184	277	0.343	0.390	YBC9_SCHPO Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi069 PE=3 SV=1
6	O22261	2.10e-53	179	312	0.359	0.362	NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NDT1 PE=1 SV=2
7	P40556	1.92e-50	173	373	0.321	0.271	YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIA6 PE=1 SV=1
8	Q8RWA5	1.36e-49	170	363	0.349	0.303	NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDT2 PE=1 SV=1
9	P40464	2.42e-48	166	311	0.311	0.315	FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLX1 PE=3 SV=1
10	P39953	5.30e-45	157	335	0.324	0.304	YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEA6 PE=1 SV=1
11	Q6I583	2.50e-37	138	355	0.314	0.279	Q6I583_ORYSJ Os05g0585900 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0585900 PE=1 SV=1
12	M9NDD0	3.46e-37	135	272	0.251	0.290	M9NDD0_DROME Replication in mitochondria 2, isoform D OS=Drosophila melanogaster OX=7227 GN=Rim2 PE=3 SV=1
13	M9ND06	1.42e-36	136	358	0.251	0.221	M9ND06_DROME Replication in mitochondria 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Rim2 PE=3 SV=1
14	Q9VQ37	1.46e-36	136	365	0.251	0.216	RIM2_DROME Mitochondrial carrier protein Rim2 OS=Drosophila melanogaster OX=7227 GN=Rim2 PE=2 SV=2
15	Q922G0	3.91e-36	134	311	0.295	0.299	S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus OX=10090 GN=Slc25a36 PE=2 SV=1
16	Q96CQ1	3.02e-35	131	311	0.292	0.296	S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens OX=9606 GN=SLC25A36 PE=1 SV=1
17	Q8BL03	2.39e-34	129	306	0.273	0.281	S2529_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus OX=10090 GN=Slc25a29 PE=1 SV=1
18	Q9UTD6	3.21e-34	130	371	0.340	0.288	YID3_SCHPO Uncharacterized mitochondrial carrier C227.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC227.03c PE=3 SV=1
19	F4JHS4	5.34e-34	129	366	0.321	0.276	F4JHS4_ARATH Adenine nucleotide transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ADNT1 PE=1 SV=1
20	Q8N8R3	8.64e-34	127	303	0.292	0.304	S2529_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens OX=9606 GN=SLC25A29 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09743 E3_UFM1_ligase	2.7e+02	12.6	E3 UFM1-protein ligase 1
2	PF00153 Mito_carr	1e-66	232.2	Mitochondrial carrier protein
3	PF11423 Repressor_Mnt	9.2e+02	11.0	Regulatory protein Mnt

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297578

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292180	0.790	FAD synthase
2	9606.ENSP00000480703	0.742	Proton-coupled folate transporter
3	9606.ENSP00000365926	0.739	Riboflavin kinase
4	9606.ENSP00000348722	0.696	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs . Acts as a regulator of protein synthesis in embryonic stem cells by mediating pseudouridylation of RNA fragments derived from tRNAs (tRFs): pseudouridylated tRFs inhibit translation by targeting the translation initiation complex . Also catalyzes pseudouridylation of mRNAs: mediates pseudouridylation of mRNAs with the consensus sequence 5'-UGUAG-3' . In addition to mRNAs and tRNAs, binds other types of RNAs, such as snRNAs, Y RNAs and vault RNAs, suggesting that it can catalyze pseudouridylation of many RNA types
5	9606.ENSP00000333667	0.673	Serine hydroxymethyltransferase, mitochondrial
6	9606.ENSP00000258494	0.671	Mitochondrial 10-formyltetrahydrofolate dehydrogenase
7	9606.ENSP00000318868	0.621	Serine hydroxymethyltransferase, cytosolic
8	9606.ENSP00000216605	0.612	C-1-tetrahydrofolate synthase, cytoplasmic
9	9606.ENSP00000353739	0.605	protein-L-isoaspartate O-methyltransferase domain containing 1
10	9606.ENSP00000362344	0.596	Folylpolyglutamate synthase, mitochondrial
11	9606.ENSP00000370192	0.591	Solute carrier family 46 member 3
12	9606.ENSP00000297579	0.584	DDB1- and CUL4-associated factor 13
13	9606.ENSP00000229729	0.582	Choline transporter-like protein 4
14	9606.ENSP00000478253	0.580	Monofunctional C1-tetrahydrofolate synthase, mitochondrial
15	9606.ENSP00000402038	0.570	Protein MTO1 homolog, mitochondrial
16	9606.ENSP00000377617	0.567	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
17	9606.ENSP00000426638	0.558	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
18	9606.ENSP00000370737	0.538	Glycine dehydrogenase (decarboxylating), mitochondrial
19	9606.ENSP00000445381	0.530	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma
20	9606.ENSP00000255389	0.528	Phosphatidylethanolamine N-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0090482	1.000	vitamin transmembrane transporter activity
GO:0072349	1.000	modified amino acid transmembrane transporter activity
GO:0042887	1.000	amide transmembrane transporter activity
GO:0046943	1.000	carboxylic acid transmembrane transporter activity
GO:0005488	0.887	binding
GO:0005515	0.774	protein binding
GO:0015605	0.592	organophosphate ester transmembrane transporter activity
GO:1901702	0.590	salt transmembrane transporter activity
GO:0015215	0.525	nucleotide transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0015711	0.998	organic anion transport
GO:0071705	0.994	nitrogen compound transport
GO:0055085	0.977	transmembrane transport
GO:0015849	0.974	organic acid transport
GO:0072337	0.972	modified amino acid transport
GO:0051180	0.968	vitamin transport
GO:1990542	0.966	mitochondrial transmembrane transport
GO:0035461	0.960	vitamin transmembrane transport
GO:0042886	0.959	amide transport
GO:0044237	0.930	cellular metabolic process
GO:0046942	0.929	carboxylic acid transport
GO:0071704	0.902	organic substance metabolic process
GO:1905039	0.866	carboxylic acid transmembrane transport
GO:0006835	0.855	dicarboxylic acid transport
GO:0006807	0.850	nitrogen compound metabolic process
GO:1901564	0.757	organonitrogen compound metabolic process
GO:0044281	0.641	small molecule metabolic process
GO:0046483	0.632	heterocycle metabolic process
GO:1901360	0.582	organic cyclic compound metabolic process
GO:0006725	0.402	cellular aromatic compound metabolic process
GO:0044238	0.366	primary metabolic process
GO:0019752	0.364	carboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.997	membrane
GO:0031090	0.954	organelle membrane
GO:0031967	0.887	organelle envelope
GO:0031966	0.860	mitochondrial membrane
GO:0019866	0.819	organelle inner membrane
GO:0005743	0.796	mitochondrial inner membrane
GO:0070013	0.460	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]