StarFunc result for job id Q9H2D6

User Input

>input (2365 residues)
MEEVPGDALCEHFEANILTQNRCQNCFHPEEAHGARYQELRSPSGAEVPYCDLPRCPPAP
EDPLSASTSGCQSVVDPGLRPGPKRGPSPSAGLPEEGPTAAPRSRSRELEAVPYLEGLTT
SLCGSCNEDPGSDPTSSPDSATPDDTSNSSSVDWDTVERQEEEAPSWDELAVMIPRRPRE
GPRADSSQRAPSLLTRSPVGGDAAGQKKEDTGGGGRSAGQHWARLRGESGLSLERHRSTL
TQASSMTPHSGPRSTTSQASPAQRDTAQAASTREIPRASSPHRITQRDTSRASSTQQEIS
RASSTQQETSRASSTQEDTPRASSTQEDTPRASSTQWNTPRASSPSRSTQLDNPRTSSTQ
QDNPQTSFPTCTPQRENPRTPCVQQDDPRASSPNRTTQRENSRTSCAQRDNPKASRTSSP
NRATRDNPRTSCAQRDNPRASSPSRATRDNPTTSCAQRDNPRASRTSSPNRATRDNPRTS
CAQRDNPRASSPSRATRDNPTTSCAQRDNPRASRTSSPNRATRDNPRTSCAQRDNPRASS
PNRAARDNPTTSCAQRDNPRASRTSSPNRATRDNPRTSCAQRDNPRASSPNRATRDNPTT
SCAQRDNPRASRTSSPNRATRDNPRTSCAQRDNPRASSPNRTTQQDSPRTSCARRDDPRA
SSPNRTIQQENPRTSCALRDNPRASSPSRTIQQENPRTSCAQRDDPRASSPNRTTQQENP
RTSCARRDNPRASSRNRTIQRDNPRTSCAQRDNPRASSPNRTIQQENLRTSCTRQDNPRT
SSPNRATRDNPRTSCAQRDNLRASSPIRATQQDNPRTCIQQNIPRSSSTQQDNPKTSCTK
RDNLRPTCTQRDRTQSFSFQRDNPGTSSSQCCTQKENLRPSSPHRSTQWNNPRNSSPHRT
NKDIPWASFPLRPTQSDGPRTSSPSRSKQSEVPWASIALRPTQGDRPQTSSPSRPAQHDP
PQSSFGPTQYNLPSRATSSSHNPGHQSTSRTSSPVYPAAYGAPLTSPEPSQPPCAVCIGH
RDAPRASSPPRYLQHDPFPFFPEPRAPESEPPHHEPPYIPPAVCIGHRDAPRASSPPRHT
QFDPFPFLPDTSDAEHQCQSPQHEPLQLPAPVCIGYRDAPRASSPPRQAPEPSLLFQDLP
RASTESLVPSMDSLHECPHIPTPVCIGHRDAPSFSSPPRQAPEPSLFFQDPPGTSMESLA
PSTDSLHGSPVLIPQVCIGHRDAPRASSPPRHPPSDLAFLAPSPSPGSSGGSRGSAPPGE
TRHNLEREEYTVLADLPPPRRLAQRQPGPQAQCSSGGRTHSPGRAEVERLFGQERRKSEA
AGAFQAQDEGRSQQPSQGQSQLLRRQSSPAPSRQVTMLPAKQAELTRRSQAEPPHPWSPE
KRPEGDRQLQGSPLPPRTSARTPERELRTQRPLESGQAGPRQPLGVWQSQEEPPGSQGPH
RHLERSWSSQEGGLGPGGWWGCGEPSLGAAKAPEGAWGGTSREYKESWGQPEAWEEKPTH
ELPRELGKRSPLTSPPENWGGPAESSQSWHSGTPTAVGWGAEGACPYPRGSERRPELDWR
DLLGLLRAPGEGVWARVPSLDWEGLLELLQARLPRKDPAGHRDDLARALGPELGPPGTND
VPEQESHSQPEGWAEATPVNGHSPALQSQSPVQLPSPACTSTQWPKIKVTRGPATATLAG
LEQTGPLGSRSTAKGPSLPELQFQPEEPEESEPSRGQDPLTDQKQADSADKRPAEGKAGS
PLKGRLVTSWRMPGDRPTLFNPFLLSLGVLRWRRPDLLNFKKGWMSILDEPGEPPSPSLT
TTSTSQWKKHWFVLTDSSLKYYRDSTAEEADELDGEIDLRSCTDVTEYAVQRNYGFQIHT
KDAVYTLSAMTSGIRRNWIEALRKTVRPTSAPDVTKLSDSNKENALHSYSTQKGPLKAGE
QRAGSEVISRGGPRKADGQRQALDYVELSPLTQASPQRARTPARTPDRLAKQEELERDLA
QRSEERRKWFEATDSRTPEVPAGEGPRRGLGAPLTEDQQNRLSEEIEKKWQELEKLPLRE
NKRVPLTALLNQSRGERRGPPSDGHEALEKEVQALRAQLEAWRLQGEAPQSALRSQEDGH
IPPGYISQEACERSLAEMESSHQQVMEELQRHHERELQRLQQEKEWLLAEETAATASAIE
AMKKAYQEELSRELSKTRSLQQGPDGLRKQHQSDVEALKRELQVLSEQYSQKCLEIGALM
RQAEEREHTLRRCQQEGQELLRHNQELHGRLSEEIDQLRGFIASQGMGNGCGRSNERSSC
ELEVLLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSGKYQDVYVELSHIKTRSEREIE
QLKEHLRLAMAALQEKESMRNSLAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99KW3	0.133	0.151	0.000	2014	0.628	0.737	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
2	AFDB:Q9H2D6	1.000	1.000	0.000	2365	1.000	1.000	Q9H2D6.pdb.gz	TARA_HUMAN TRIO and F-actin-binding protein OS=Homo sapiens OX=9606 GN=TRIOBP PE=1 SV=3
3	PDB:3ljuX	0.039	0.230	1.935E-6	373	0.013	0.080	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
4	PDB:6bbpA	0.035	0.151	8.730E-6	520	0.010	0.046	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
5	PDB:4mk0A	0.037	0.136	1.414E-5	631	0.007	0.027	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
6	PDB:3uzsA	0.037	0.134	3.094E-5	609	0.007	0.028	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
7	AFDB:Q8INM3	0.025	0.038	3.490E-5	1420	0.082	0.137	Q8INM3.pdb.gz	SLE_DROME Protein slender lobes OS=Drosophila melanogaster OX=7227 GN=sle PE=1 SV=1
8	AFDB:Q5HZI1	0.041	0.076	4.182E-5	1210	0.094	0.183	Q5HZI1.pdb.gz	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
9	PDB:4uudC	0.037	0.621	4.442E-5	113	0.008	0.168	4uudC.pdb.gz
10	AFDB:Q8N3D4	0.024	0.032	1.314E-4	1523	0.087	0.135	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
11	AFDB:H2KYH3	0.040	0.039	1.396E-4	2476	0.102	0.097	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
12	AFDB:Q8BI84	0.040	0.049	1.672E-4	1930	0.085	0.105	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
13	PDB:6u3eA	0.034	0.194	1.776E-4	397	0.011	0.063	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
14	AFDB:F1M842	0.035	0.038	1.776E-4	1972	0.119	0.143	F1M842.pdb.gz	F1M842_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=3
15	AFDB:Q12888	0.033	0.033	2.260E-4	1972	0.108	0.129	Q12888.pdb.gz	TP53B_HUMAN TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
16	PDB:4mt6A	0.036	0.202	2.401E-4	389	0.011	0.064	4mt6A.pdb.gz
17	PDB:7rx9A	0.033	0.173	3.056E-4	432	0.008	0.046	7rx9A.pdb.gz
18	PDB:6hhgA	0.035	0.196	4.659E-4	386	0.006	0.039	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
19	AFDB:P32334	0.029	0.041	4.947E-4	1306	0.080	0.145	P32334.pdb.gz	MSB2_YEAST Signaling mucin MSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSB2 PE=1 SV=1
20	PDB:3pvuA	0.037	0.139	4.948E-4	609	0.006	0.025	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99KW3	0.0	2420	2014	0.561	0.659	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
2	Q9H2D6	0.0	4730	2365	1.000	1.000	TARA_HUMAN TRIO and F-actin-binding protein OS=Homo sapiens OX=9606 GN=TRIOBP PE=1 SV=3
3	J3KSW8	4.16e-128	428	844	0.112	0.315	J3KSW8_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=1
4	Q6WCQ1	3.67e-126	428	1025	0.112	0.259	MPRIP_HUMAN Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=3
5	A0A494BZV2	1.68e-62	240	2425	0.059	0.057	A0A494BZV2_HUMAN Myosin phosphatase Rho interacting protein OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=1
6	H0Y7E2	1.95e-62	237	1091	0.059	0.127	H0Y7E2_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=3
7	H0Y2S9	2.39e-61	236	1794	0.059	0.077	H0Y2S9_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=3
8	H7C3G6	1.09e-54	195	277	0.048	0.408	H7C3G6_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=2
9	Q9ERE6	1.07e-43	177	1029	0.034	0.079	MPRIP_RAT Myosin phosphatase Rho-interacting protein OS=Rattus norvegicus OX=10116 GN=Mprip PE=1 SV=1
10	J3QRL2	6.76e-19	89.0	181	0.018	0.232	J3QRL2_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=1
11	A1L2F7	1.95e-09	65.5	669	0.027	0.097	A1L2F7_DANRE G patch domain-containing protein 3 OS=Danio rerio OX=7955 GN=gpatch3 PE=2 SV=1
12	G4SLH0	6.82e-07	57.8	18562	0.033	0.004	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
13	Q7SZL5	3.48e-05	52.0	1338	0.025	0.045	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
14	Q27320	3.49e-05	51.2	393	0.025	0.148	Q27320_DROME I71-7 OS=Drosophila melanogaster OX=7227 GN=Eig71Ee PE=2 SV=1
15	B6RSP1	2.62e-04	48.9	1197	0.015	0.030	PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio OX=7955 GN=plekha7 PE=2 SV=2
16	I3ITL5	6.65e-04	47.8	2041	0.012	0.014	I3ITL5_DANRE Myosin X,-like 1 OS=Danio rerio OX=7955 GN=myo10l1 PE=3 SV=1
17	E9PEW5	0.001	46.6	1397	0.019	0.031	E9PEW5_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
18	A0A0A0MQX1	0.002	46.6	2069	0.019	0.021	A0A0A0MQX1_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
19	Q9HD67	0.002	46.2	2058	0.019	0.021	MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=3
20	F8VQB6	0.005	45.1	2062	0.019	0.021	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07902 Gp58	4.3e+02	10.6	gp58-like protein
2	PF00169 PH	6.1e-12	57.3	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384312

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387100	0.767	Taperin
2	9606.ENSP00000367059	0.753	Espin
3	9606.ENSP00000297784	0.738	Transmembrane channel-like protein 1
4	9606.ENSP00000391641	0.727	Zinc finger protein 780B
5	9606.ENSP00000482885	0.701	Phosphatidylinositol phosphatase PTPRQ
6	9606.ENSP00000480514	0.696	Calcium load-activated calcium channel
7	9606.ENSP00000358001	0.680	Transforming acidic coiled-coil-containing protein 2
8	9606.ENSP00000205890	0.672	Unconventional myosin-XV
9	9606.ENSP00000401513	0.630	Stereocilin
10	9606.ENSP00000356370	0.605	Protein crumbs homolog 1
11	9606.ENSP00000328327	0.604	Ankyrin repeat and SOCS box protein 7
12	9606.ENSP00000283228	0.603	Receptor-type tyrosine-protein phosphatase R
13	9606.ENSP00000381768	0.602	Cadherin-23
14	9606.ENSP00000324775	0.597	Transmembrane inner ear expressed protein
15	9606.ENSP00000248384	0.595	Olfactory receptor 1E2
16	9606.ENSP00000358994	0.589	Unconventional myosin-VI
17	9606.ENSP00000351732	0.583	Transmembrane channel-like protein 2
18	9606.ENSP00000386331	0.579	Unconventional myosin-VIIa
19	9606.ENSP00000339115	0.567	Espin-like protein
20	9606.ENSP00000386647	0.559	Pejvakin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	1.000	ubiquitin protein ligase binding
GO:0051015	1.000	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.975	regulation of biological process
GO:0048522	0.955	positive regulation of cellular process
GO:0009987	0.814	cellular process
GO:0045785	0.800	positive regulation of cell adhesion
GO:1900024	0.789	regulation of substrate adhesion-dependent cell spreading
GO:1900026	0.634	positive regulation of substrate adhesion-dependent cell spreading
GO:0032501	0.414	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0030054	0.990	cell junction
GO:0005856	0.990	cytoskeleton
GO:0070161	0.970	anchoring junction
GO:0015629	0.959	actin cytoskeleton
GO:0005737	0.916	cytoplasm
GO:0016020	0.915	membrane
GO:0030055	0.870	cell-substrate junction
GO:0005925	0.789	focal adhesion
GO:0043227	0.765	membrane-bounded organelle
GO:0071944	0.723	cell periphery
GO:0005886	0.501	plasma membrane
GO:0043231	0.436	intracellular membrane-bounded organelle
GO:0005829	0.435	cytosol
GO:0070013	0.415	intracellular organelle lumen
GO:0005576	0.331	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]