StarFunc result for job id Q9H2E6

User Input

>input (1030 residues)
MRSEALLLYFTLLHFAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQM
IMIMNGTLYIAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF
IKVLLKKNDDALFVCGTNAFNPSCRNYKMDTLEPFGDEFSGMARCPYDAKHANVALFADG
KLYSATVTDFLAIDAVIYRSLGESPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIA
VEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVT
DVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIASVFTGRFKEQKSPDSTWTPVPDER
VPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNRPWFLRTMVRYRL
TKIAVDTAAGPYQNHTVVFLGSEKGIILKFLARIGNSGFLNDSLFLEEMSVYNSEKCSYD
GVEDKRIMGMQLDRASSSLYVAFSTCVIKVPLGRCERYGKCKKTCIASRDPYCGWIKEGG
ACSHLSPNSRLTFEQDIERGNTDGLGDCHNSFVALNGHSSSLLPSTTTSDSTAQEGYESR
GGMLDWKHLLDSPDSTDPLGAVSSHNHQDKKGVIRESYLKGHDQLVPVTLLAIAVILAFV
MGAVFSGITVYCVCDHRRKDVAVVQRKEKELTHSRRGSMSSVTKLSGLFGDTQSKDPKPE
AILTPLMHNGKLATPGNTAKMLIKADQHHLDLTALPTPESTPTLQQKRKPSRGSREWERN
QNLINACTKDMPPMGSPVIPTDLPLRASPSHIPSVVVLPITQQGYQHEYVDQPKMSEVAQ
MALEDQAATLEYKTIKEHLSSKSPNHGVNLVENLDSLPPKVPQREASLGPPGASLSQTGL
SKRLEMHHSSSYGVDYKRSYPTNSLTRSHQATTLKRNNTNSSNSSHLSRNQSFGRGDNPP
PAPQRVDSIQVHSSQPSGQAVTVSRQPSLNAYNSLTRSGLKRTPSLKPDVPPKPSFAPLS
TSMKPNDACT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35464	0.695	0.694	0.000	1031	0.950	0.949	O35464.pdb.gz	SEM6A_MOUSE Semaphorin-6A OS=Mus musculus OX=10090 GN=Sema6a PE=1 SV=2
2	AFDB:Q6P7E1	0.594	0.631	0.000	968	0.683	0.727	Q6P7E1.pdb.gz	Q6P7E1_DANRE Semaphorin-6A precursor OS=Danio rerio OX=7955 GN=zgc:66106 PE=2 SV=1
3	AFDB:Q76KF0	0.548	0.527	3.595E-103	1073	0.479	0.459	Q76KF0.pdb.gz	SEM6D_MOUSE Semaphorin-6D OS=Mus musculus OX=10090 GN=Sema6d PE=1 SV=1
4	AFDB:E3W9A6	0.572	0.554	1.330E-93	1064	0.410	0.397	E3W9A6.pdb.gz	E3W9A6_DANRE Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6E OS=Danio rerio OX=7955 GN=bZ1N7.1 PE=2 SV=1
5	PDB:6qp7A	0.436	0.711	2.584E-50	620	0.181	0.300	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
6	AFDB:Q1RMY5	0.340	0.642	4.603E-47	537	0.211	0.404	Q1RMY5.pdb.gz	Q1RMY5_HUMAN SEMA6C protein OS=Homo sapiens OX=9606 GN=SEMA6C PE=1 SV=1
7	PDB:3nvqA	0.402	0.685	2.193E-32	588	0.139	0.243	3nvqA.pdb.gz
8	PDB:3nvnA	0.315	0.795	3.097E-20	383	0.077	0.206	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
9	PDB:6vxkB	0.283	0.380	2.192E-14	747	0.077	0.106	6vxkB.pdb.gz
10	AFDB:P25365	0.194	0.189	3.198E-8	1065	0.126	0.122	P25365.pdb.gz	SED4_YEAST Putative guanine nucleotide-exchange factor SED4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SED4 PE=1 SV=1
11	PDB:6ttuT	0.216	0.502	4.374E-8	394	0.041	0.107	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
12	PDB:7mq8LR	0.122	0.151	1.710E-7	773	0.038	0.050	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:6jp6A	0.190	0.195	3.669E-7	998	0.034	0.035	6jp6A.pdb.gz
14	PDB:5wyjBE	0.119	0.153	3.875E-7	753	0.056	0.077	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
15	PDB:7ajuCH	0.164	0.320	4.321E-7	467	0.051	0.113	7ajuCH.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:5c2vB	0.214	0.554	9.272E-7	352	0.045	0.131	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
17	AFDB:Q389F7	0.214	0.202	1.304E-6	1105	0.111	0.103	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
18	AFDB:Q9C0J8	0.240	0.191	2.799E-6	1336	0.109	0.084	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
19	AFDB:Q09847	0.221	0.178	5.686E-6	1325	0.100	0.078	Q09847.pdb.gz	NU146_SCHPO Nucleoporin nup146 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup146 PE=1 SV=1
20	AFDB:Q9V4C8	0.153	0.114	4.462E-4	1500	0.115	0.079	Q9V4C8.pdb.gz	HCF_DROME Host cell factor OS=Drosophila melanogaster OX=7227 GN=Hcf PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E3W9A6	0.0	744	1064	0.444	0.430	E3W9A6_DANRE Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6E OS=Danio rerio OX=7955 GN=bZ1N7.1 PE=2 SV=1
2	O35464	0.0	2008	1031	0.950	0.950	SEM6A_MOUSE Semaphorin-6A OS=Mus musculus OX=10090 GN=Sema6a PE=1 SV=2
3	O54951	0.0	722	886	0.320	0.372	SEM6B_MOUSE Semaphorin-6B OS=Mus musculus OX=10090 GN=Sema6b PE=1 SV=1
4	Q6P7E1	0.0	1393	968	0.677	0.720	Q6P7E1_DANRE Semaphorin-6A precursor OS=Danio rerio OX=7955 GN=zgc:66106 PE=2 SV=1
5	Q76KF0	0.0	881	1073	0.485	0.466	SEM6D_MOUSE Semaphorin-6D OS=Mus musculus OX=10090 GN=Sema6d PE=1 SV=1
6	Q8NFY4	0.0	890	1073	0.489	0.470	SEM6D_HUMAN Semaphorin-6D OS=Homo sapiens OX=9606 GN=SEMA6D PE=1 SV=1
7	Q9H2E6	0.0	2154	1030	0.999	0.999	SEM6A_HUMAN Semaphorin-6A OS=Homo sapiens OX=9606 GN=SEMA6A PE=1 SV=3
8	Q9H3T2	0.0	559	930	0.303	0.335	SEM6C_HUMAN Semaphorin-6C OS=Homo sapiens OX=9606 GN=SEMA6C PE=2 SV=4
9	Q9H3T3	0.0	726	888	0.322	0.374	SEM6B_HUMAN Semaphorin-6B OS=Homo sapiens OX=9606 GN=SEMA6B PE=1 SV=4
10	Q9WTM3	9.19e-177	541	931	0.303	0.335	SEM6C_MOUSE Semaphorin-6C OS=Mus musculus OX=10090 GN=Sema6c PE=2 SV=1
11	Q9WTL3	1.57e-175	540	960	0.299	0.321	SEM6C_RAT Semaphorin-6C OS=Rattus norvegicus OX=10116 GN=Sema6c PE=2 SV=1
12	Q1RMY5	6.63e-125	393	537	0.179	0.343	Q1RMY5_HUMAN SEMA6C protein OS=Homo sapiens OX=9606 GN=SEMA6C PE=1 SV=1
13	Q24322	3.42e-104	349	899	0.212	0.242	SEM1A_DROME Semaphorin-1A OS=Drosophila melanogaster OX=7227 GN=Sema1a PE=1 SV=3
14	O08665	4.22e-96	323	772	0.190	0.254	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
15	Q63548	4.35e-96	323	772	0.190	0.254	SEM3A_RAT Semaphorin-3A OS=Rattus norvegicus OX=10116 GN=Sema3a PE=2 SV=1
16	Q14563	8.50e-96	323	771	0.186	0.249	SEM3A_HUMAN Semaphorin-3A OS=Homo sapiens OX=9606 GN=SEMA3A PE=1 SV=1
17	Q9W686	9.74e-96	323	778	0.185	0.246	SE3AB_DANRE Semaphorin-3ab OS=Danio rerio OX=7955 GN=sema3ab PE=2 SV=1
18	O44253	7.27e-95	320	770	0.180	0.240	O44253_DROME Similar to semaphorin-I OS=Drosophila melanogaster OX=7227 GN=Sema1b PE=2 SV=1
19	Q7KK54	1.34e-94	319	770	0.179	0.239	Q7KK54_DROME MIP07328p OS=Drosophila melanogaster OX=7227 GN=Sema1b PE=1 SV=1
20	Q13214	6.25e-94	317	749	0.184	0.254	SEM3B_HUMAN Semaphorin-3B OS=Homo sapiens OX=9606 GN=SEMA3B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01437 PSI	0.0061	28.4	Plexin repeat
2	PF01403 Sema	1.3e-45	167.0	Sema domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000017566

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000000270	0.970	Plexin A2
2	9601.ENSPPYP00000020209	0.887	Plexin A4
3	9601.ENSPPYP00000015040	0.878	Plexin A1
4	9601.ENSPPYP00000023373	0.872	Plexin A3
5	9601.ENSPPYP00000002562	0.836	Neuropilin
6	9601.ENSPPYP00000001025	0.811	Semaphorin 6C
7	9601.ENSPPYP00000015001	0.799	Plexin D1
8	9601.ENSPPYP00000023830	0.791	Plexin C1
9	9601.ENSPPYP00000012687	0.733	Synaptojanin 1
10	9601.ENSPPYP00000019090	0.729	RALBP1 associated Eps domain containing 1
11	9601.ENSPPYP00000014643	0.723	Neuropilin 2
12	9601.ENSPPYP00000023338	0.721	Plexin B3
13	9601.ENSPPYP00000018604	0.664	Belongs to the protein kinase superfamily. Tyr protein kinase family
14	9601.ENSPPYP00000015506	0.660	Macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
15	9601.ENSPPYP00000020106	0.657	Hepatocyte growth factor receptor
16	9601.ENSPPYP00000008754	0.628	CRK proto-oncogene, adaptor protein
17	9601.ENSPPYP00000013933	0.625	SOS Ras/Rac guanine nucleotide exchange factor 1
18	9601.ENSPPYP00000016323	0.615	Ras-related protein Rab-28
19	9601.ENSPPYP00000006785	0.614	NUMB, endocytic adaptor protein
20	9601.ENSPPYP00000015368	0.612	Prickle planar cell polarity protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0030215	0.950	semaphorin receptor binding
GO:0060089	0.925	molecular transducer activity
GO:0038023	0.923	signaling receptor activity
GO:0042802	0.840	identical protein binding
GO:0004888	0.807	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0009987	0.987	cellular process
GO:0032501	0.986	multicellular organismal process
GO:0048856	0.986	anatomical structure development
GO:0050794	0.986	regulation of cellular process
GO:0007275	0.974	multicellular organism development
GO:0007399	0.950	nervous system development
GO:0016043	0.939	cellular component organization
GO:0051716	0.926	cellular response to stimulus
GO:0007154	0.917	cell communication
GO:0023052	0.916	signaling
GO:0007165	0.904	signal transduction
GO:0009653	0.878	anatomical structure morphogenesis
GO:0048583	0.852	regulation of response to stimulus
GO:0040012	0.849	regulation of locomotion
GO:0048519	0.848	negative regulation of biological process
GO:0048518	0.848	positive regulation of biological process
GO:0051239	0.847	regulation of multicellular organismal process
GO:0050793	0.845	regulation of developmental process
GO:0048869	0.833	cellular developmental process
GO:0023051	0.823	regulation of signaling
GO:0010646	0.823	regulation of cell communication
GO:2000145	0.807	regulation of cell motility
GO:0022603	0.802	regulation of anatomical structure morphogenesis
GO:0030154	0.796	cell differentiation
GO:0007166	0.794	cell surface receptor signaling pathway
GO:0048522	0.786	positive regulation of cellular process
GO:0030335	0.742	positive regulation of cell migration
GO:0016477	0.741	cell migration
GO:0009966	0.740	regulation of signal transduction
GO:0040011	0.700	locomotion
GO:0048468	0.634	cell development
GO:0048523	0.625	negative regulation of cellular process
GO:0071526	0.579	semaphorin-plexin signaling pathway
GO:0071363	0.553	cellular response to growth factor stimulus
GO:0035924	0.538	cellular response to vascular endothelial growth factor stimulus
GO:1902531	0.502	regulation of intracellular signal transduction
GO:0042221	0.492	response to chemical
GO:0030182	0.396	neuron differentiation
GO:0048666	0.388	neuron development
GO:0051128	0.377	regulation of cellular component organization
GO:0048513	0.369	animal organ development
GO:0009605	0.360	response to external stimulus
GO:0051179	0.351	localization
GO:0030155	0.337	regulation of cell adhesion
GO:0048812	0.327	neuron projection morphogenesis
GO:0042330	0.319	taxis
GO:0006935	0.302	chemotaxis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.894	intracellular anatomical structure
GO:0005737	0.752	cytoplasm
GO:0043226	0.720	organelle
GO:0043227	0.706	membrane-bounded organelle
GO:0012505	0.368	endomembrane system
GO:0043229	0.337	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]