StarFunc result for job id Q9H2F5

User Input

>input (836 residues)
MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEESEHHLQRAIS
AQQVYGEKRDNMVIPVPEAESNIAYYESIYPGEFKMPKQLIHIQPFSLDAEQPDYDLDSE
DEVFVNKLKKKMDICPLQFEEMIDRLEKGSGQQPVSLQEAKLLLKEDDELIREVYEYWIK
KRKNCRGPSLIPSVKQEKRDGSSTNDPYVAFRRRTEKMQTRKNRKNDEASYEKMLKLRRD
LSRAVTILEMIKRREKSKRELLHLTLEIMEKRYNLGDYNGEIMSEVMAQRQPMKPTYAIP
IIPITNSSQFKHQEAMDVKEFKVNKQDKADLIRPKRKYEKKPKVLPSSAAATPQQTSPAA
LPVFNAKDLNQYDFPSSDEEPLSQVLSGSSEAEEDNDPDGPFAFRRKAGCQYYAPHLDQT
GNWPWTSPKDGGLGDVRYRYCLTTLTVPQRCIGFARRRVGRGGRVLLDRAHSDYDSVFHH
LDLEMLSSPQHSPVNQFANTSETNTSDKSFSKDLSQILVNIKSCRWRHFRPRTPSLHDSD
NDELSCRKLYRSINRTGTAQPGTQTCSTSTQSKSSSGSAHFAFTAEQYQQHQQQLALMQK
QQLAQIQQQQANSNSSTNTSQNLASNQQKSGFRLNIQGLERTLQGFVSKTLDSASAQFAA
SALVTSEQLMGFKMKDDVVLGIGVNGVLPASGVYKGLHLSSTTPTALVHTSPSTAGSALL
QPSNITQTSSSHSALSHQVTAANSATTQVLIGNNIRLTVPSSVATVNSIAPINARHIPRT
LSAVPSSALKLAAAANCQVSKVPSSSSVDSVPRENHESEKPALNNIADNTVAMEVT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A6E4	0.363	0.394	0.000	762	0.853	0.936	D4A6E4.pdb.gz	D4A6E4_RAT Enhancer of polycomb homolog 1 OS=Rattus norvegicus OX=10116 GN=Epc1 PE=1 SV=3
2	AFDB:Q9H2F5	1.000	1.000	0.000	836	1.000	1.000	Q9H2F5.pdb.gz	EPC1_HUMAN Enhancer of polycomb homolog 1 OS=Homo sapiens OX=9606 GN=EPC1 PE=1 SV=1
3	AFDB:Q52LR7	0.357	0.369	1.528E-69	807	0.543	0.563	Q52LR7.pdb.gz	EPC2_HUMAN Enhancer of polycomb homolog 2 OS=Homo sapiens OX=9606 GN=EPC2 PE=1 SV=2
4	AFDB:F1RDZ9	0.368	0.401	9.708E-64	751	0.482	0.537	F1RDZ9.pdb.gz
5	PDB:7vvuT	0.214	0.582	1.306E-6	274	0.060	0.182	7vvuT.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
6	AFDB:A0A0B4KF25	0.042	0.037	3.125E-2	1131	0.111	0.082	A0A0B4KF25.pdb.gz	A0A0B4KF25_DROME Reduction in Cnn dots 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
7	AFDB:A0A0G2K7W4	0.045	0.031	3.534E-2	1348	0.134	0.083	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
8	AFDB:Q4GYI3	0.048	0.045	3.997E-2	912	0.087	0.080	Q4GYI3.pdb.gz	Q4GYI3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3940 PE=4 SV=1
9	AFDB:Q57U40	0.055	0.062	5.114E-2	739	0.150	0.169	Q57U40.pdb.gz	Q57U40_TRYB2 Nucleoporin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.6H23.320 PE=4 SV=1
10	AFDB:P32618	0.061	0.055	5.439E-2	956	0.120	0.105	P32618.pdb.gz	YEF3_YEAST Uncharacterized protein YEL043W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEL043W PE=1 SV=1
11	AFDB:Q9UBL0	0.051	0.051	5.784E-2	812	0.120	0.123	Q9UBL0.pdb.gz	ARP21_HUMAN cAMP-regulated phosphoprotein 21 OS=Homo sapiens OX=9606 GN=ARPP21 PE=1 SV=2
12	PDB:6blbA	0.052	0.116	9.388E-1	311	0.014	0.039	6blbA.pdb.gz	1.88 Angstrom Resolution Crystal Structure Holliday Junction ATP-dependent DNA Helicase (RuvB) from Pseudomonas aeruginosa in Complex with ADP.
13	PDB:5iy7M	0.058	0.129	1.738	310	0.019	0.052	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
14	PDB:5j0nF	0.037	0.060	1.848	356	0.017	0.039	5j0nF.pdb.gz	Structure of a Holliday junction complex reveals mechanisms governing a highly regulated DNA transaction.
15	PDB:6bzoF	0.048	0.111	1.848	326	0.025	0.064	6bzoF.pdb.gz	Fidaxomicin jamsMycobacterium tuberculosisRNA polymerase motions needed for initiation via RbpA contacts.
16	PDB:5x6cA	0.067	0.098	2.223	539	0.022	0.033	5x6cA.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
17	PDB:6hivCb	0.045	0.094	2.674	252	0.036	0.119	6hivCb.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
18	PDB:7vdvW	0.080	0.242	3.025	248	0.030	0.101	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
19	PDB:2mgsA	0.033	0.245	3.421	71	0.006	0.070	2mgsA.pdb.gz
20	PDB:5yamA	0.035	0.261	3.421	69	0.016	0.188	5yamA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6G2P8	0.0	1425	812	0.916	0.943	A0A8I6G2P8_RAT Enhancer of polycomb homolog OS=Rattus norvegicus OX=10116 GN=Epc1 PE=3 SV=1
2	A0A8I6GEL3	0.0	1318	764	0.855	0.936	A0A8I6GEL3_RAT Enhancer of polycomb homolog 1 OS=Rattus norvegicus OX=10116 GN=Epc1 PE=4 SV=1
3	D4A6E4	0.0	1318	762	0.855	0.938	D4A6E4_RAT Enhancer of polycomb homolog 1 OS=Rattus norvegicus OX=10116 GN=Epc1 PE=1 SV=3
4	Q52LR7	0.0	726	807	0.536	0.555	EPC2_HUMAN Enhancer of polycomb homolog 2 OS=Homo sapiens OX=9606 GN=EPC2 PE=1 SV=2
5	Q7ZUK6	0.0	661	751	0.486	0.541	Q7ZUK6_DANRE Enhancer of polycomb homolog OS=Danio rerio OX=7955 GN=zgc:55784 PE=2 SV=1
6	Q9H2F5	0.0	1744	836	1.000	1.000	EPC1_HUMAN Enhancer of polycomb homolog 1 OS=Homo sapiens OX=9606 GN=EPC1 PE=1 SV=1
7	A0A0B4KEK1	4.76e-119	399	1974	0.282	0.120	A0A0B4KEK1_DROME Enhancer of polycomb-like protein OS=Drosophila melanogaster OX=7227 GN=E(Pc) PE=1 SV=1
8	A0A0B4KFP2	4.29e-104	356	2097	0.203	0.081	A0A0B4KFP2_DROME Enhancer of polycomb-like protein OS=Drosophila melanogaster OX=7227 GN=E(Pc) PE=1 SV=1
9	A0A0B4KET9	4.43e-104	356	2033	0.203	0.084	A0A0B4KET9_DROME Enhancer of polycomb-like protein OS=Drosophila melanogaster OX=7227 GN=E(Pc) PE=1 SV=1
10	Q0E9C2	4.44e-104	356	2023	0.203	0.084	Q0E9C2_DROME Enhancer of polycomb-like protein OS=Drosophila melanogaster OX=7227 GN=E(Pc) PE=1 SV=1
11	O96542	5.57e-104	355	2023	0.203	0.084	O96542_DROME Enhancer of polycomb-like protein OS=Drosophila melanogaster OX=7227 GN=E(Pc) PE=2 SV=1
12	A0A8I6A414	1.84e-28	110	60	0.063	0.883	A0A8I6A414_RAT Enhancer of polycomb homolog 1 OS=Rattus norvegicus OX=10116 GN=Epc1 PE=4 SV=1
13	Q4KM29	1.11e-27	112	190	0.061	0.268	Q4KM29_RAT Epc1 protein OS=Rattus norvegicus OX=10116 GN=Epc1 PE=2 SV=1
14	Q9UU94	4.57e-22	103	557	0.114	0.171	EPL1_SCHPO Enhancer of polycomb-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=epl1 PE=3 SV=1
15	P43572	4.09e-15	82.0	832	0.092	0.093	EPL1_YEAST Enhancer of polycomb-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EPL1 PE=1 SV=1
16	Q8GYQ9	4.76e-12	71.2	453	0.104	0.192	Q8GYQ9_ARATH Enhancer of polycomb-like protein OS=Arabidopsis thaliana OX=3702 GN=YUP8H12R.36 PE=1 SV=1
17	Q5AAG1	4.17e-07	56.2	753	0.071	0.078	EPL1_CANAL Enhancer of polycomb-like protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EPL1 PE=3 SV=1
18	Q7YZH1	3.40e-05	50.4	3241	0.038	0.010	RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster OX=7227 GN=rno PE=1 SV=1
19	D3ZUW8	0.009	42.4	1189	0.039	0.028	D3ZUW8_RAT Bromodomain containing 1 OS=Rattus norvegicus OX=10116 GN=Brd1 PE=4 SV=3
20	G5E8P1	0.015	41.6	1058	0.039	0.031	BRD1_MOUSE Bromodomain-containing protein 1 OS=Mus musculus OX=10090 GN=Brd1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12253 CAF1A	6.6e+02	11.9	Chromatin assembly factor 1 subunit A
2	PF10513 EPL1	5.8e-07	41.7	Enhancer of polycomb-like
3	PF06752 E_Pc_C	8.1e-97	335.4	Enhancer of Polycomb C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263062

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247843	0.999	YEATS domain-containing protein 4
2	9606.ENSP00000340330	0.999	Histone acetyltransferase KAT5
3	9606.ENSP00000361363	0.999	DNA methyltransferase 1-associated protein 1
4	9606.ENSP00000362166	0.999	Chromatin modification-related protein MEAF6
5	9606.ENSP00000331310	0.998	Mortality factor 4-like protein 1
6	9606.ENSP00000352925	0.998	Transformation/transcription domain-associated protein
7	9606.ENSP00000359518	0.997	MRG/MORF4L-binding protein
8	9606.ENSP00000320566	0.992	Inhibitor of growth protein 3
9	9606.ENSP00000397552	0.989	Actin-like protein 6A
10	9606.ENSP00000473172	0.989	RuvB-like 2
11	9606.ENSP00000374213	0.986	E1A-binding protein p400
12	9606.ENSP00000394417	0.986	Mortality factor 4-like protein 2
13	9606.ENSP00000318297	0.981	RuvB-like 1
14	9606.ENSP00000406037	0.961	Histone acetyltransferase KAT8
15	9606.ENSP00000332194	0.959	Histone H2A type 2-C
16	9606.ENSP00000346464	0.958	Vacuolar protein sorting-associated protein 72 homolog
17	9606.ENSP00000349960	0.951	Actin, cytoplasmic 1
18	9606.ENSP00000312244	0.947	Male-specific lethal 3 homolog
19	9606.ENSP00000254900	0.946	Bromodomain-containing protein 8
20	9606.ENSP00000332790	0.924	Histone H2A type 2-B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140463	0.925	chromatin-protein adaptor activity
GO:0140767	0.914	enzyme-substrate adaptor activity
GO:0003824	0.473	catalytic activity
GO:0016740	0.356	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.970	organic substance metabolic process
GO:0050794	0.969	regulation of cellular process
GO:0044238	0.967	primary metabolic process
GO:0019222	0.959	regulation of metabolic process
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:0019219	0.948	regulation of nucleobase-containing compound metabolic process
GO:2001020	0.928	regulation of response to DNA damage stimulus
GO:0048869	0.926	cellular developmental process
GO:0032501	0.919	multicellular organismal process
GO:0006807	0.913	nitrogen compound metabolic process
GO:0006282	0.898	regulation of DNA repair
GO:2001022	0.891	positive regulation of response to DNA damage stimulus
GO:0051054	0.888	positive regulation of DNA metabolic process
GO:2000779	0.886	regulation of double-strand break repair
GO:0010569	0.883	regulation of double-strand break repair via homologous recombination
GO:0016573	0.877	histone acetylation
GO:2000781	0.857	positive regulation of double-strand break repair
GO:0045911	0.852	positive regulation of DNA recombination
GO:0010468	0.849	regulation of gene expression
GO:1903506	0.816	regulation of nucleic acid-templated transcription
GO:0006355	0.781	regulation of DNA-templated transcription
GO:0043967	0.701	histone H4 acetylation
GO:0051726	0.685	regulation of cell cycle
GO:0071840	0.634	cellular component organization or biogenesis
GO:0044237	0.629	cellular metabolic process
GO:0048519	0.619	negative regulation of biological process
GO:0016043	0.601	cellular component organization
GO:0006325	0.562	chromatin organization
GO:0050896	0.548	response to stimulus
GO:0006357	0.544	regulation of transcription by RNA polymerase II
GO:0048523	0.533	negative regulation of cellular process
GO:0048856	0.507	anatomical structure development
GO:0030154	0.474	cell differentiation
GO:0045893	0.427	positive regulation of DNA-templated transcription
GO:0051716	0.388	cellular response to stimulus
GO:0031324	0.333	negative regulation of cellular metabolic process
GO:0010605	0.306	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0035267	1.000	NuA4 histone acetyltransferase complex
GO:0005634	0.999	nucleus
GO:0000786	0.995	nucleosome
GO:0031981	0.989	nuclear lumen
GO:0016020	0.981	membrane
GO:0005654	0.980	nucleoplasm
GO:0012505	0.973	endomembrane system
GO:0031090	0.821	organelle membrane
GO:0031967	0.807	organelle envelope
GO:0005635	0.791	nuclear envelope
GO:0032777	0.671	Piccolo NuA4 histone acetyltransferase complex
GO:0031965	0.668	nuclear membrane
GO:0005737	0.414	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.356	Transferases.

[back to server]